KEGG   Magnetospirillum magneticum: amb3132Help
Entry
amb3132           CDS       T00305                                 

Definition
(GenBank) GTPase - translation elongation factor
  KO
K02358  elongation factor Tu
Organism
mag  Magnetospirillum magneticum
Brite
KEGG Orthology (KO) [BR:mag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mag03012]
    amb3132
   03029 Mitochondrial biogenesis [BR:mag03029]
    amb3132
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mag04147]
    amb3132
Translation factors [BR:mag03012]
 Eukaryotic Type
  Elongation factors
   amb3132
 Prokaryotic Type
   amb3132
Mitochondrial biogenesis [BR:mag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    amb3132
Exosome [BR:mag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   amb3132
  Exosomal proteins of breast cancer cells
   amb3132
  Exosomal proteins of colorectal cancer cells
   amb3132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: BAE51936
UniProt: Q2W2H3
LinkDB All DBs
Position
complement(3377433..3378623)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETSNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKCDMVDDPELLDLVELEVRELLSSYDFPGDDIPIVRGSALCALE
DKQPEIGRDAILKLMAEVDAYIPQPERPKDKPFLMPIEDVFSISGRGTVVTGRVERGVVK
VGEEVEIVGIKNTVKTTCTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAAPGS
ITPHTDFEAEAYILNKEEGGRHTPFFTNYRPQFYFRTTDVTGVVALPEGTEMVMPGDNVK
MIVTLIAPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggctaaattcgagcgcaacaagcctcactgcaacatcgggaccatcggtcac
gttgaccatggcaagacctcgctgaccgcggcgatcaccaagatcctggccgagaccggc
ggcgccaccttcaccgcctacgaccagatcgacaaggcgccggaagagaaggcccgtggc
atcaccatctcgaccgcccacgtcgagtacgagaccagcaaccgccactacgcccacgtg
gactgccccggtcacgccgactatgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgccatcctggtggtgtcggccgccgacggccccatgccccagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgccggccctggtggtgttcatgaacaagtgcgacatg
gtcgacgatcccgagctgctggatctggtcgagctggaagtgcgcgagctgctgagctcg
tatgacttccccggcgacgacattccgatcgtgcgcggttcggccctgtgtgccctggaa
gacaagcagccggagatcggccgcgacgccatcctgaagctgatggccgaagtggacgcc
tacatcccgcagccggagcgtccgaaggacaagccgttcctgatgccgatcgaagacgtg
ttctccatctcgggccgtggcaccgtggtgaccggccgcgtcgagcgtggcgtggtcaag
gtgggcgaggaagtcgagatcgtcggcatcaagaacaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctcgatcagggtgaggccggcgacaacatcggcgccctg
ctgcgcggcaccaagcgcgaggacgtggagcgcggccaggttctggcggctccgggctcc
atcacgccccacaccgacttcgaggccgaagcctacatcctgaacaaggaagagggcggc
cgtcacaccccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgtggttgctctgccggaaggcaccgagatggtgatgccgggcgacaacgtgaag
atgatcgtgaccctgatcgcccccatcgccatggaccagggcctgcgcttcgccatccgc
gaaggcggccggaccgtcggcgccggcgtggtggccaagatcatcaagtag

DBGET integrated database retrieval system