KEGG   Microbulbifer agarilyticus: Mag101_03195Help
Entry
Mag101_03195      CDS       T04709                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00473  D-Alanine metabolism
maga00550  Peptidoglycan biosynthesis
maga01100  Metabolic pathways
maga01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:maga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mag101_03195
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mag101_03195
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Mag101_03195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:maga01011]
    Mag101_03195
Enzymes [BR:maga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mag101_03195
Peptidoglycan biosynthesis and degradation proteins [BR:maga01011]
 Precursor biosynthesis
  Amino acid ligase
   Mag101_03195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AQQ66754
UniProt: A0A1Q2M223
LinkDB All DBs
Position
complement(758205..759224)
Genome map
AA seq 339 aa AA seqDB search
MTNESANPINVLLICGGGSSEHDVSLRTADFIQQELGKSAEFQLTRVTMDADGRFIDADG
QLRELRSDKLLYNAGGSAQPVDYVIPAIHGYPGETGDLQSQLEILGLPYYGCGPEASKNC
FNKVTTKLWLTALGIDNTPYKFLCAETAEEFAKAQDALSQWGSVFVKASNQGSSVGCYQV
STPEALNEALKDAFKLSPYVLVEKCLNVRELEVAAYEYHGELVVTPPGEVRAPSDTFYSY
DEKYAEDSRAETFVEAEGLSEGQLDWIREASRRAFVGLQLKDLSRIDFFLTDEGEIYLNE
VNTFPGMTSISMFPKMLKNQGHDFSEYLGTLIHNAVKLT
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgagtctgccaatcccatcaacgtcctgctgatctgcggcggcggcagcagc
gaacacgatgtatccctgcgcaccgcggattttattcaacaggagctgggcaagtcagca
gaatttcaactgacacgggtgaccatggatgcggatggccgctttatcgatgcggacggc
cagctgcgcgaattgcgctcggacaaactgctgtacaacgccggtggcagtgcgcagcct
gtggactatgtaatcccggccatccacggctaccccggtgaaaccggcgacctacagtca
caactggaaattctcggcctgccctattacggctgcggccccgaggccagcaagaattgt
ttcaacaaggtcaccaccaaactgtggctgaccgcactgggcatcgacaataccccctac
aagttcctgtgtgcggaaaccgcagaggagtttgccaaggcccaggatgcgctgagccag
tggggctcggtctttgtgaaagcctccaatcagggctcatcggtgggctgctatcaggtg
agcactccggaagctctcaatgaagcattgaaggatgcattcaaactctctccctacgta
ctggtagaaaagtgcctgaatgtgcgcgagctggaagttgcggcctacgaataccatggc
gaactggtggtaaccccaccgggcgaagtgcgcgcgccgtcggacaccttctacagctac
gatgaaaaatatgcagaagacagccgcgcagaaacctttgtggaagctgaggggttgtcc
gagggccaactggactggattcgcgaagcatcgagacgcgcgtttgtcggcctgcagcta
aaagacctttcccgcatcgacttcttcctcaccgatgaaggcgagatctacctgaacgaa
gtgaataccttccccggtatgacctcgatctccatgtttccgaagatgctgaagaatcag
gggcatgatttttcggaatatcttggcacattaattcacaacgctgtgaaattgacttga

DBGET integrated database retrieval system