KEGG   Microbulbifer agarilyticus: Mag101_03225Help
Entry
Mag101_03225      CDS       T04709                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
maga  Microbulbifer agarilyticus
Brite
KEGG Orthology (KO) [BR:maga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:maga01001]
    Mag101_03225
Enzymes [BR:maga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Mag101_03225
Protein kinases [BR:maga01001]
 Serine/threonine kinases: Other
  Bacterial family
   Mag101_03225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_19 TPR_2 Kdo TPR_12 ANAPC3 TPR_1 TPR_16 TPR_14 TPR_11 TPR_10 TPR_6 TPR_8 Pkinase_fungal APH TPR_15 TPR_17 TPR_21 PknG_TPR
Motif
Other DBs
NCBI-ProteinID: AQQ66760
UniProt: A0A1Q2M266
LinkDB All DBs
Position
complement(765315..767957)
Genome map
AA seq 880 aa AA seqDB search
MDIADPDVVQKSNATDAREETPQLGSDRYRVLSTLGAGGMGVVYLAEDLKLHRKVAVKKL
RDDIASQNARERIQQEARLLAQLNHPNIVALHDVLEETAGSDTSVALVMEYIEGTTLRAW
MRERSPSLQQKLSLLMQICLGLQQAHDLGIIHRDLKADNILIAENAKGEPVAKITDFGIA
KSQQLDEKTLTAENQLAGTITAMSPEQILGKTLTARSDLFSLGAIAFELLCGSRPFEKHE
AGALAMANRITSEPHIPPQQAWRNIPDPLAVLLDKLLAKEPAQRPESAQIVYQGFALLHK
QGMEAEAEDFTATLTDLFTQQKVKSRRRWQRITTGVAATLVLGTGSYWGWKEITRLEPQY
IAVMPVEINGEIRGEENAKALTKTMVRQALMNSISHLKGSALLRFKPDNSSERKNNFNEL
VNLGATHAISAQLLCEASNCQVNIELIDPNSVTLTNQISFSSPLSLIQESEFKISSVTAS
LFDEKYRNKKYASLQMNPENYNTYLAIASKANQDSTTKFDLELLEKLLETHSQNTSLYKL
HTQISFDLFTRTGKKEFLIEGLQQLRKAKQRKVPQEIILELEFRLRSQLDQSADIDGLAQ
KMKELNFPSSSLLTQYAKFLQSQGNYEDSQKYLDEAIKIHPSSESYYISAINLYLTGDYE
KAIRKLYLAIEKNQKSIKPLSLLSGILIEKGEYIESEKIIKSIPKTDLDWYLQTNLGTAF
LLQKRYEEALQEYRNALSKSPNNITIIGNIAETLLLLNKKSEAKNYFEQLKKLTANKNSP
ENRSYYAQAIAYLGSPGEAIEIIHQLNSNYPENSDVKYISSQVYILGGEYNSAGYQIKQL
LNQGMSKDWFLLPVYKDFCEKAAAPGAAGTAICSQINLEL
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagaccccgacgttgtacaaaaaagcaacgcaaccgatgctcgcgaggag
acgccacagttaggcagcgaccgctaccgtgtactcagcacgctaggtgcgggcggcatg
ggagttgtctacctcgctgaagacctgaagctgcaccgcaaagtggcggttaagaagctc
cgcgacgatatcgccagccaaaacgcccgcgaacgcatccagcaggaagcccgcctgctc
gcccaactcaatcacccgaatattgtcgccctgcacgatgtgctggaagaaaccgccggc
agtgacaccagcgtcgccctggtaatggaatatatcgagggcaccacactgcgcgcgtgg
atgcgcgagcgcagccccagcctgcagcagaagctcagcctactgatgcagatctgcctg
ggcctgcagcaggcccacgacctcggcatcattcaccgcgacctcaaggccgacaacatc
ctgattgcggaaaacgccaagggcgagccggtggccaaaatcaccgatttcggcatcgcc
aaatcccagcagctggacgagaagaccctcaccgcggaaaaccagctggccggcaccatc
accgccatgtcgccggagcagatcctcggtaaaacactcaccgcacgcagcgacctgttt
agcctcggtgcgatagcatttgagttactgtgcggcagccgtccgtttgaaaagcacgaa
gccggcgcgctggccatggccaaccgcattaccagcgaaccgcatatcccgccgcagcag
gcatggcgaaatattcccgatccgcttgcggtactgctggacaagctcctcgccaaagaa
cccgcgcagcgcccggaaagcgcgcagattgtgtatcagggctttgccctgctgcacaaa
caggggatggaagcggaagcagaagatttcaccgcaactctgaccgatttgtttactcaa
cagaaagtcaaaagccgtcggcgctggcagcggattactaccggtgttgccgccacactg
gtactgggtactggaagctactggggctggaaggaaattacccgactggagccacaatat
attgcggtaatgccggtggaaattaacggggaaattcgcggggaggagaatgccaaggcg
ctgaccaaaactatggtgcggcaggcattgatgaattcgatttcgcacttaaagggaagt
gcactactacgattcaaacccgacaactcctcagagaggaaaaataatttcaacgagctt
gtaaacttgggggcaacacatgccattagcgcacaattactctgcgaggcaagtaattgc
caggtgaatattgaattaatcgaccccaactccgtgactctcactaaccagataagcttt
agctctccactatctcttattcaggaatcagaattcaaaatcagcagtgtcacagcaagc
ctatttgacgaaaaatatcgaaataagaaatatgcttcgctacaaatgaatcccgagaat
tacaacacttatctcgctatagcatctaaagcaaaccaagattcaacaaccaaatttgac
ctcgagcttctggagaaactactagaaacgcactcacaaaacacttcactctacaaacta
cacactcagatcagcttcgaccttttcaccagaacaggaaaaaaagaatttttaatagaa
ggactacagcaattacgcaaagccaaacaaagaaaagtccctcaagaaattattttagaa
ctcgaatttagattgcgaagccagttagaccaatcagccgacattgatggcttggcccag
aaaatgaaagaacttaacttcccaagctcttctcttttaacgcaatatgcgaaattcctt
caatctcaaggcaactacgaagacagccaaaaatatctcgacgaagcaataaaaatccat
ccatcatcagaatcctactacatatctgcaataaatctctatctaactggcgactatgag
aaggcaataagaaaactttatctggctattgaaaaaaaccaaaagagtataaaaccacta
tccttgctttccggaattcttatagagaaaggggaatatatagaatcggaaaaaataata
aaatcaatcccaaaaaccgacttggattggtacttgcagacaaacttggggacagccttt
cttttacagaaaagatatgaagaagctctccaagaataccgaaacgcactctcaaaatct
ccaaacaacatcaccataattggaaacattgccgagacgttgcttttattaaacaaaaaa
tcagaagcaaaaaattacttcgaacagctgaaaaaactaactgcgaataagaactcacca
gaaaatcgcagctattacgctcaagcaattgcatacctgggaagccctggggaggcgatc
gaaataattcatcagctaaattcaaattacccagaaaactccgatgttaaatatatatca
tcgcaagtttacatcttagggggcgaatacaactccgcaggatatcaaataaaacaactg
ctaaatcaaggcatgagtaaagactggtttctactcccggtatataaggatttttgcgaa
aaagcagctgcgccaggtgctgcaggcacagctatttgctcacaaatcaatctggaatta
tga

DBGET integrated database retrieval system