KEGG   Microbulbifer agarilyticus: Mag101_04630Help
Entry
Mag101_04630      CDS       T04709                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00970  Aminoacyl-tRNA biosynthesis
maga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maga00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mag101_04630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:maga03029]
    Mag101_04630
Enzymes [BR:maga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mag101_04630
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mag101_04630
Mitochondrial biogenesis [BR:maga03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mag101_04630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AQQ67002
UniProt: A0A1Q2M450
LinkDB All DBs
Position
complement(1128396..1129850)
Genome map
AA seq 484 aa AA seqDB search
MHQLTIAEIIRGLRDKQFSSVELTSHYLERIQQLDSQFNSFITVTSEQALNEAATADARL
AQGDAPALCGVPVAHKDIFCTNGVRTSCGSKMLDNFVPPYDATVIDNFQQAGAISLGKTN
MDEFAMGSSNETSFYGAVKNPWDVERIPGGSSGGSAAAVAALLAPGATATDTGGSIRQPA
AMTGTTGLKPTYGRVSRWGMIAFASSLDQGGPITRTAEDAALMLSVMASPDAKDSTCLDR
PVQDYTAQLNDSIAGLKIGVPSEYFGEGLDSEVGARVQDALKEYEKLGAELVEISLPHSK
LAVPAYYVIAPAEASANLSRFDGVRYGYRCENPADLRDLYMRSRGEGFGEEVKRRILVGS
YALSAGYYDAYYNKAQQVRRLIKQDFVDAFDKVDVIMGPTAPNPAFKLGEKNADPVAMYL
EDIYTIATNLAGLPGMSIPCGFAHGLPVGLQIIGNYLDEARMLNVAHQFQQASDWHQQTA
PAVK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagttgaccatcgccgagatcatccgcggcctgcgcgacaaacaattctccagc
gttgaactcaccagccactatctggaacgcatccagcagctcgacagccagttcaacagt
tttatcaccgtcaccagcgagcaggcactgaatgaggccgcaactgccgacgcccgcctg
gcgcagggcgatgccccggccctgtgtggtgtacctgtggcgcacaaggacattttctgc
accaacggcgtacgcaccagctgtggctcgaagatgctggacaacttcgtaccgccctac
gacgccaccgtgatcgacaacttccagcaggccggcgccatcagtctgggcaagaccaat
atggatgagttcgccatgggctcctccaacgaaaccagtttttacggcgcggtgaaaaac
ccttgggatgtagagcgcattcccggcggctcctccggtggttccgccgctgcggtcgcg
gcactgctggcaccgggcgcaacagctaccgacaccggtggctcgattcgccagccagcc
gccatgaccggtaccactggcctcaaaccgacctatggccgggtgtcacgctggggcatg
attgcgttcgcctccagcctggaccagggcggcccgatcacgcgtaccgcggaagacgcc
gcgctgatgctgtcggtaatggcaagccccgatgcgaaagactccacctgcctggatcgc
ccggtgcaggactacaccgcgcaactgaacgactccatcgctggcctcaagatcggtgta
ccaagtgaatacttcggggaaggcctcgatagcgaagtgggcgcccgcgttcaggacgca
ctgaaggaatacgagaaactcggtgccgagctggtggaaatcagcctgccgcacagcaag
ctggcggtgccggcttattacgtaatcgcaccggcggaagcctccgccaacctgtcgcgc
ttcgatggcgtgcgctacggctaccgctgtgaaaaccccgcggatctgcgcgatctgtat
atgcgctcccgtggtgaaggcttcggcgaagaagtgaaacgccgcattttagtcggcagc
tacgccctgtctgccggctattacgatgcttactacaacaaagcccagcaggtgcgccgc
ctgatcaagcaggactttgtcgacgccttcgataaggtcgatgtcatcatgggtccaact
gcacccaaccccgcattcaagctgggcgagaagaatgccgacccggtggctatgtatctg
gaagacatttacaccatcgccaccaacctggccggcctgcccggcatgtccatcccctgc
ggttttgcccacggcctgcccgtcggcctgcagatcattggcaactacctggacgaagca
cgcatgttgaatgtggcgcaccagttccagcaagccagtgactggcatcaacaaaccgcc
ccggcagtaaaataa

DBGET integrated database retrieval system