KEGG   Microbulbifer agarilyticus: Mag101_06040Help
Entry
Mag101_06040      CDS       T04709                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
  KO
K00065  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase [EC:1.1.1.127]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00040  Pentose and glucuronate interconversions
maga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mag101_06040
Enzymes [BR:maga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.127  2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
     Mag101_06040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Eno-Rase_NADH_b RmlD_sub_bind GDP_Man_Dehyd THF_DHG_CYH_C Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AQQ67245
UniProt: A0A1Q2M3D5
LinkDB All DBs
Position
1521087..1521851
Genome map
AA seq 254 aa AA seqDB search
MLQQFSLAGKKALVTGCNRGIGKAMAVALAEAGADVIGVSANLDLSDSQVGREVAAAGQQ
FFPYQCDFSDRNSLYGFIDKVKSEHPQIDILVNNAGTILRAPAAEHGDDLWDKVIEVNLN
AQFILSREIGKEMVARGAGKIIFTASLLTFQGGITVPGYAASKGAIGQIAMALSNEWASK
GVNVNAIAPGYIATDNTQALREDSERAASILARIPQGRWGEPADFKGPVVFLASEASNYM
NGSVLLVDGGWMGR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagcaatttagcctcgccggtaaaaaagccctggttaccggttgtaatcgcggt
attggtaaagccatggcggtcgctctggcagaagcgggtgcggacgtgatcggcgtatct
gccaacctggatttgagtgactctcaagtgggtcgcgaggtggcagccgcaggtcagcag
ttctttccctaccagtgcgatttttcagaccgcaactcgctgtatggttttatcgacaag
gttaaaagcgaacacccgcaaatcgatatcctggtaaacaatgccggtacgattttacgc
gccccggcggcagagcacggagacgacctgtgggataaggtgatcgaagttaacctgaac
gcacaatttattttgagtcgcgaaatcggcaaggaaatggtcgcgcgcggcgctgggaaa
attattttcaccgcgtcgctgcttaccttccagggtggtattactgttccggggtacgcc
gcgagtaaaggtgcgattgggcaaatcgccatggcgctgtccaatgaatgggcttccaag
ggcgttaacgtgaatgcgattgccccgggatatatcgccaccgataacacccaggcgctg
cgcgaagacagtgagcgcgcagcgagtatcctcgcccgtatcccacaggggcgctggggc
gaacccgcagacttcaaggggccggtagtcttcctggcttccgaagcctctaactacatg
aatggcagcgtcctgttggtggacggtggctggatggggagataa

DBGET integrated database retrieval system