KEGG   Microbulbifer agarilyticus: Mag101_07660Help
Entry
Mag101_07660      CDS       T04709                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:maga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mag101_07660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:maga01001]
    Mag101_07660
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:maga02044]
    Mag101_07660
Enzymes [BR:maga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Mag101_07660
Protein kinases [BR:maga01001]
 Serine/threonine kinases: Other
  Bacterial family
   Mag101_07660
Secretion system [BR:maga02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Mag101_07660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Pkinase Pkinase_Tyr PEGA APH Pkinase_fungal Kinase-like CarboxypepD_reg Haspin_kinase Mfp-3 Alpha_GJ
Motif
Other DBs
NCBI-ProteinID: AQQ67529
UniProt: A0A1Q2M4E3
LinkDB All DBs
Position
complement(1878982..1881426)
Genome map
AA seq 814 aa AA seqDB search
MEVVSSGAASLEIPGYQILKKINQGGMSTVYLATQRSMGRQVALKVMSPVLNADPIFSER
FQREANIVGQLSHPNIVAIHDIGRYRSLNYIAMDYLPGGSVADALTKGAIEPLDALHIAR
QIAMALDHASNKGYVHRDLKPENILFREDGSAILTDFGVARAVARTTRMTNTGMVVGTPH
YMSPEQARGAAVDGRADLYSLGVVFYEMLTSAVPYQAEEAVAIAIKHLTDPIPRLPARHT
LYQGLIDRFLAKDPEQRFQRGLDVVDAIDQLLAALDGKSPAPSTKMNNTSVRVSSLLRAL
VLTLYGTLSDRIAAAWARFRDKPVHQQNPRAEQQTIMRIRQVVEQAAPIKPRSKMFFGLL
AVSFTLAWVLFSLFSNKFQWQTESGLVNEAVDITSQILLPENGAPQAGQATAELPGLSSD
LLPGSLVVQEPAPSQTGPVLRNTPVAAAITEATPSAAAPQPETAETGNIANVEEPITTAA
INSTDADQAPQEPEVASPPPTYALKVSPTPGDARIRIMNIVPRYTPGISLEPGRYDVEVS
KPGFSTVRRWVEIDSANVNLAVQLERKYFAGKSFQSPLKDGGRGPEMVVISPGAFTMGNN
TRPFTSPEHKITIRRPYAIGAHEVTFNDYDRYAKASGRSLPSDQGWGRGTRPLINVSWVD
AQRYAKWLSEQSGQKYRLASEAEWEFAARADTDTPFWWGDGSPRGKANCRRGCASEFNSL
FAAKSAPVGNYKANQFGLYDTAGNVGEWVQDCFLGDFTNHRSDARPVQLKNCDLRVVRGG
SMREPLRNISSDYRTGLNERAHSKEVGFRLVMEL
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggaagttgtcagcagcggcgccgcctcgctggagatccctggctaccagatcctgaaa
aaaattaatcagggcggtatgtctaccgtatatctggccactcagcgcagtatgggacgc
caggtcgctctcaaggtgatgtctcccgtccttaacgccgacccaattttcagcgagcga
ttccagcgcgaagccaatattgttggccagctgtcccaccccaatattgttgccatccac
gacatcggccgctaccgcagcctcaattacatcgccatggactacctcccaggtggctcc
gtggcggacgcgctgaccaaaggcgccattgagcctctcgacgccctgcacattgcccgc
cagattgccatggcactggaccacgcgagcaacaaaggctatgtgcaccgcgacctgaaa
cccgagaacatcctgtttcgggaagacggctcagcgattctcaccgacttcggcgtggcg
cgtgcagttgcacgtaccacacgcatgaccaacaccgggatggtggtgggtactccccac
tatatgagcccggaacaggcgcgaggcgcggccgtcgatgggcgtgctgacctgtacagc
ctcggcgtcgtcttttatgaaatgcttaccagtgcggtgccctatcaggccgaagaagcc
gttgctatcgcaattaagcacctgaccgacccgattcctcgcctgcctgcgcgacacacc
ttgtaccagggcctcatcgaccgcttcctcgccaaagatcccgaacagcgcttccagcgt
ggactggacgtggtcgacgcgatcgatcagttgctcgcggcgctggatggtaaaagcccg
gctcctagcaccaagatgaataacacctcggtgcgcgtttccagtttgttgcgcgcactg
gtgctcaccctgtacggcaccctatccgatcgtatcgccgccgcctgggcgcgctttcgc
gacaagccggttcaccaacaaaacccgcgcgccgaacagcaaaccatcatgcgtattcgg
caagtggtggagcaagcagcacccatcaaacccagatcgaaaatgttttttggtctgctc
gccgtaagtttcacactcgcgtgggtcctgttcagcctgtttagcaacaagttccagtgg
caaaccgagtcgggcctggtgaatgaagcggtcgatatcacttcacagatactgctgccg
gagaatggcgcgccgcaagctggacaagctactgcggaattgccgggcctttccagcgac
ctcctcccgggcagtttggtagtgcaagaaccggctcctagccaaactggcccggtatta
cgcaacacgccggtcgcagcggcaatcacggaggccacacccagcgctgctgccccgcaa
cctgaaaccgccgagactggcaatattgccaatgtagaagaaccaattaccacggccgcc
atcaatagcacggatgccgaccaggctccgcaggaacctgaagtagcctccccgccgccg
acctacgctctcaaggtttcaccaacacccggcgatgcgcgcattcgcatcatgaacatc
gttccacgatatacgccgggaatcagccttgagcctggtcgctatgacgttgaggtgagc
aagcccggcttcagtactgtgcggcgatgggtggagatcgattccgctaacgtgaatctc
gcggtacagctggagcgcaaatactttgccggcaagagttttcaatccccactcaaagac
ggtggtcgtggcccggaaatggtggtgatctcacccggtgctttcaccatgggcaacaac
acgcgtccgttcacgagtcccgaacacaaaatcacgatccggcgcccctatgcaattggc
gcgcacgaagtgacgtttaacgactatgaccgctatgcgaaagccagcggccgcagcttg
cccagcgatcagggatggggccggggtacacgcccgctgatcaacgtgagctgggttgat
gcacagcgctatgcaaagtggctgagtgaacagagcgggcagaagtatcgtttggcgagt
gaagcggagtgggaatttgccgcgcgcgccgatactgacactcccttctggtggggtgat
ggcagtccccgcggcaaggccaactgccgccgcggctgcgccagcgaattcaactctctg
tttgccgccaagagcgcaccggtcggcaactacaaagccaaccagtttggcttgtacgat
accgcgggcaacgttggtgaatgggtacaggattgtttcctcggcgatttcaccaaccac
cgcagcgatgcgcgccctgtacagttgaaaaactgcgatctgcgcgtcgtccgtggcggc
tccatgcgtgaaccgctccgcaacatcagctcagactaccgcaccggtctgaatgagcgc
gcccactccaaagaagtgggcttccgcctggtaatggagctgtaa

DBGET integrated database retrieval system