KEGG   Microbulbifer agarilyticus: Mag101_08825Help
Entry
Mag101_08825      CDS       T04709                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00020  Citrate cycle (TCA cycle)
maga00270  Cysteine and methionine metabolism
maga00620  Pyruvate metabolism
maga00630  Glyoxylate and dicarboxylate metabolism
maga00680  Methane metabolism
maga01100  Metabolic pathways
maga01110  Biosynthesis of secondary metabolites
maga01120  Microbial metabolism in diverse environments
maga01130  Biosynthesis of antibiotics
maga01200  Carbon metabolism
Module
maga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
maga_M00012  Glyoxylate cycle
maga_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:maga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mag101_08825
   00620 Pyruvate metabolism
    Mag101_08825
   00630 Glyoxylate and dicarboxylate metabolism
    Mag101_08825
  Energy metabolism
   00680 Methane metabolism
    Mag101_08825
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mag101_08825
Enzymes [BR:maga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Mag101_08825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AQQ67730
UniProt: A0A1Q2M513
LinkDB All DBs
Position
complement(2154114..2155094)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQISYSLLFRIASGEMLGKDQPVILQLLEITPALEALKGVAMELEDC
AFPLLAGIVQSDDATVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKALNDVA
SRDVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRALTQLANKTDSTVNDITH
MTIWGNHSATQYPDLHQAKVNGEDAMGKVEQEWYETDFIPTVQQRGAAIIKARGASSAAS
AANAAIDHMRDWALGSAEGDWTSMGVYSDGSYGIAKGLIYSFPVVCKNGDWEIVQGVDIN
DFSREKMTATEQELAEERDAVAHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacctgttcgtgttgcagttaccggcgccgccggtcagatcagctactcccta
ctgttccgcatcgcttctggcgaaatgctgggtaaggatcaaccagttattcttcagctg
ctggaaattactcccgctctggaagccctgaaaggcgtagcgatggaactggaagactgt
gccttcccgctgctggcaggaatcgttcagtctgacgatgcaaccgttgcctttaaagac
gcagattacgcactgctggttggcgcccgtccgcgtggcccaggtatggagcgtaaagac
ctgctggaagccaacgccgcaatcttctctgcgcagggtaaagccctgaacgacgtagct
tcccgcgacgtgaaagtactggttgttggcaacccggccaacaccaacgcactgatcgct
cagcgcaatgcgcctgatctggacccgcgtaacttcaccgccatgacccgtctggaccac
aaccgtgccctgactcagctggcgaacaagaccgattccaccgtcaacgacattacccac
atgactatctggggtaaccactctgcgactcagtaccctgacctgcaccaggccaaggta
aatggcgaagacgcgatgggtaaagtagagcaggagtggtacgagactgacttcatcccg
actgttcagcagcgcggtgccgccatcatcaaggcacgtggtgcttcctctgctgcttcc
gcagccaacgctgctatcgaccacatgcgcgattgggctctgggttccgctgaaggcgac
tggaccagcatgggtgtatacagcgatggctcttacggtatcgctaaaggcttgatctac
tccttcccggttgtttgcaaaaacggcgactgggaaatcgttcagggcgtagacatcaat
gatttctctcgcgagaagatgactgcgaccgagcaggaactggctgaagagcgcgatgct
gtagcgcacctgctgccgtaa

DBGET integrated database retrieval system