KEGG   Microbulbifer agarilyticus: Mag101_10405Help
Entry
Mag101_10405      CDS       T04709                                 

Definition
(GenBank) RNAse R
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
maga  Microbulbifer agarilyticus
Brite
KEGG Orthology (KO) [BR:maga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:maga03016]
    Mag101_10405
Enzymes [BR:maga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Mag101_10405
Transfer RNA biogenesis [BR:maga03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    Mag101_10405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 S1 OB_RNB RNase_II_C_S1
Motif
Other DBs
NCBI-ProteinID: AQQ68001
UniProt: A0A1Q2M5P0
LinkDB All DBs
Position
2522265..2524214
Genome map
AA seq 649 aa AA seqDB search
MLNADALKQLSQLKSDIRSTKEFAEGRVRGANGKFGFVVLDDGREAFLPPAEMDRVFPGD
RVKVSLTEEDKGKLSAELDSLISTELKYLVGQYVQRGQGHFIQPSEHGFSRWIFLPPKAR
GKAQPGEFIACSISRHPFKDGKSQAKVESVIGKPDMAGIEHAFVVAQHRLPNTFSKGALE
QAEAIPAQLESICTDRKDLSELGFVTIDSESTRDMDDAIAITKTDAGWTLHIAVADPSSL
IEAGSPLDKDALARANSVYLAGETLPMLPAGLCENSFSLLEGQLRPALVMHIVVSEDGAL
NGFEYEFAAIRSQHKLSYSQVAQYIDGDAAAVPETQHQALSELNALSKARAQYRSGHSLV
MEDRPDYDLILNEKRKIERIEKQERTSAQRMVEEAMLAANISAGGKLAELGAGCFSIHLG
FRDERMTEIRALLKDVMPEYAEQDLHQLDVYLKLVKTLEADEDAEKKNTLAVLKRMLRPG
ELSGNAAAHLGLGIAHYATVTSPIRKFNDLHNHRVLRAAADQQTLPTLADEHGEALQQSV
TTGRQADRALQQWLYCQYLENKIDQTFTGKITLVNGAGIGVRLDDNGINGFVRFNSKKNP
FDFDGKRLRITRGEEQFQLDQEVRVKVSAVDTDKRRIAFELVTETAASE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacgccgatgccctcaaacagctgtcccagctgaagtccgatatccgctccacc
aaagaatttgccgaaggacgcgtacgcggcgccaacggtaaatttggctttgtggtactg
gatgacgggcgcgaggctttcctgcccccagccgaaatggatcgagttttcccgggcgac
cgcgttaaggtgagcctgaccgaagaagataagggcaaactgtccgcggagctggatagc
ctgatctccaccgaactgaagtacctggtgggccagtatgtacaacgtggtcagggtcac
tttatccagcccagcgagcacggcttttcgcgctggatctttttgccgcccaaagcccgc
ggcaaggcgcaaccgggggagttcatcgcctgtagcatttcccgccacccgttcaaagac
ggtaagtcccaggcaaaagtagaaagcgtaatcggcaagcccgatatggccggaatcgag
cacgcctttgtggtcgcgcaacaccgcctgcccaacacgtttagcaaaggtgccctcgag
caggcagaagccattcccgcgcagctggagagcatctgcacagaccgcaaggatctttcg
gagcttggttttgtcaccatcgattctgaaagcacccgcgatatggacgatgccatcgcg
attacgaaaaccgacgcaggctggactctgcacatcgccgtagccgacccttccagtctg
atcgaagccggcagcccgctggacaaagacgcgcttgcgcgggccaacagtgtgtatctc
gccggcgaaaccctgccaatgttgcctgcaggtttgtgcgagaacagtttctccctgctg
gaaggccagctgcgccctgctctggtgatgcatattgtggtatccgaagacggcgcgctg
aacggtttcgaatacgagtttgccgcgatccgctcccagcacaagctgagctatagccag
gttgcccagtacatcgatggcgatgccgctgcagtgccagaaacccagcatcaggccctt
agtgaactgaacgccctcagtaaagcgcgtgcacagtaccgctctggccactctctggta
atggaagaccgcccggactacgacctgattctgaatgaaaagcgcaagatcgagcgcatc
gaaaagcaggagcgtacttctgcccaacgcatggttgaagaagccatgctggccgcgaat
atttcggcgggcggcaagctcgccgaactcggtgccggctgtttctccatccatctgggc
ttccgcgacgaacgcatgaccgagatccgcgccctgctgaaagacgtgatgccggagtac
gcagagcaggacctgcaccagctcgacgtctacctcaagttggtaaaaacccttgaagcc
gatgaggatgcagagaagaagaatacgctggcggtgctcaaacgcatgctgcgcccaggc
gaactgtccggcaatgccgccgcccacctcggcctgggcattgcccactacgccaccgtg
acctcgccgatccgcaagttcaacgacctgcacaaccaccgggtactgcgtgccgctgct
gatcagcaaaccctaccaaccctggccgacgaacacggtgaagccctgcagcaaagtgtc
accactggccgccaggcagaccgcgccctgcaacagtggctgtactgccagtatctggaa
aacaaaatcgaccagacctttactggcaaaatcaccctggtcaacggtgcgggtatcggc
gtacgcctggacgacaacggcatcaatggatttgtgcgctttaacagcaaaaagaatcca
ttcgatttcgacggcaagcgcctgcgcattacccgcggagaagagcagttccagctggat
caagaagtgcgcgtaaaagtaagcgccgtagatactgataagcgacgcattgcgtttgaa
ctggttacggaaaccgcggctagcgagtaa

DBGET integrated database retrieval system