KEGG   Microbulbifer agarilyticus: Mag101_11120
Entry
Mag101_11120      CDS       T04709                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:maga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mag101_11120
Enzymes [BR:maga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mag101_11120
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mag101_11120
    1.1.1.-  
     Mag101_11120
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C Pyr_redox_3 Pyr_redox_2
Other DBs
NCBI-ProteinID: AQQ68123
UniProt: A0A1Q2M5V8
LinkDB
Position
2680979..2682016
AA seq 345 aa
MKAAVFKEVGQPLSVETVEDPTPSSGELVMKVAYCGVCGTDLHATREGLTTACCGQILGH
EFVGEIAEVGKHAEGNWAVGDRVCSIPFIGCGKCAACATGQFFQCEEKKISGVNDQGGFA
EYVTAGARETILIPDSLDLKTAALIEPLAVGLHAVRVANLKAGDRVLITGAGPIGLTVAL
WAKFFGARDVVVSELAESRAELAKKMGANHVVQPDVSAGAMGLLEQFSDLTGSAPDIIFE
CVGAPGLLQQCMEIAPYGGKIVPVGVCEQPDNIMPFLGLVKELNLQFAIAYTKDDFETSI
AMLAERRIDIEPMITDVVSLDDLPGVFEALRTPTHQCKVLTQISQ
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaagcagcggtgtttaaagaggttggccagccattgagcgttgaaaccgttgaggat
ccaacgccctcctccggcgaactggttatgaaggtcgcttactgcggcgtttgtggcaca
gatctccacgccacccgcgaaggcttgaccacagcctgctgcggacaaatcctcgggcat
gagtttgtcggtgagattgccgaggtaggtaaacacgctgagggtaattgggcggttggc
gaccgggtttgctcaataccgtttatcggttgtgggaagtgtgcagcctgtgcaaccggg
caattcttccagtgcgaggaaaagaagatatctggcgtaaatgatcagggcggctttgcc
gaatatgtcaccgctggcgcacgcgaaaccatcctcatcccagacagtctggacctcaaa
accgcagccctgattgagccgctggctgtcgggctgcacgcagtacgtgtcgccaatcta
aaagccggcgaccgagtactgatcaccggcgcaggccccattgggctcacggtcgcgctt
tgggccaaattctttggggctcgggacgttgttgtcagtgagcttgccgagtcccgtgca
gaactggctaagaagatgggagccaatcacgtggttcaaccggacgtcagtgccggtgcc
atggggctgctcgagcaatttagtgaccttactggttcagcaccggacatcatttttgaa
tgcgtcggcgctcccggcctgctgcagcagtgtatggaaattgccccttatggcggcaag
attgtaccggtgggggtatgtgagcaaccggacaacatcatgcccttcctgggcctggtc
aaagaactcaacctgcaattcgccatcgcctacaccaaggacgactttgagacatcaatc
gccatgctcgcagaacgacgcattgatatcgagccaatgattaccgatgtggtgagtctc
gatgacttacccggtgtttttgaggcgctgagaacgccaacgcaccaatgcaaggtgctt
acgcaaatcagccagtag

DBGET integrated database retrieval system