KEGG   Microbulbifer agarilyticus: Mag101_11120Help
Entry
Mag101_11120      CDS       T04709                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
maga  Microbulbifer agarilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AQQ68123
UniProt: A0A1Q2M5V8
LinkDB All DBs
Position
2680979..2682016
Genome map
AA seq 345 aa AA seqDB search
MKAAVFKEVGQPLSVETVEDPTPSSGELVMKVAYCGVCGTDLHATREGLTTACCGQILGH
EFVGEIAEVGKHAEGNWAVGDRVCSIPFIGCGKCAACATGQFFQCEEKKISGVNDQGGFA
EYVTAGARETILIPDSLDLKTAALIEPLAVGLHAVRVANLKAGDRVLITGAGPIGLTVAL
WAKFFGARDVVVSELAESRAELAKKMGANHVVQPDVSAGAMGLLEQFSDLTGSAPDIIFE
CVGAPGLLQQCMEIAPYGGKIVPVGVCEQPDNIMPFLGLVKELNLQFAIAYTKDDFETSI
AMLAERRIDIEPMITDVVSLDDLPGVFEALRTPTHQCKVLTQISQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggtgtttaaagaggttggccagccattgagcgttgaaaccgttgaggat
ccaacgccctcctccggcgaactggttatgaaggtcgcttactgcggcgtttgtggcaca
gatctccacgccacccgcgaaggcttgaccacagcctgctgcggacaaatcctcgggcat
gagtttgtcggtgagattgccgaggtaggtaaacacgctgagggtaattgggcggttggc
gaccgggtttgctcaataccgtttatcggttgtgggaagtgtgcagcctgtgcaaccggg
caattcttccagtgcgaggaaaagaagatatctggcgtaaatgatcagggcggctttgcc
gaatatgtcaccgctggcgcacgcgaaaccatcctcatcccagacagtctggacctcaaa
accgcagccctgattgagccgctggctgtcgggctgcacgcagtacgtgtcgccaatcta
aaagccggcgaccgagtactgatcaccggcgcaggccccattgggctcacggtcgcgctt
tgggccaaattctttggggctcgggacgttgttgtcagtgagcttgccgagtcccgtgca
gaactggctaagaagatgggagccaatcacgtggttcaaccggacgtcagtgccggtgcc
atggggctgctcgagcaatttagtgaccttactggttcagcaccggacatcatttttgaa
tgcgtcggcgctcccggcctgctgcagcagtgtatggaaattgccccttatggcggcaag
attgtaccggtgggggtatgtgagcaaccggacaacatcatgcccttcctgggcctggtc
aaagaactcaacctgcaattcgccatcgcctacaccaaggacgactttgagacatcaatc
gccatgctcgcagaacgacgcattgatatcgagccaatgattaccgatgtggtgagtctc
gatgacttacccggtgtttttgaggcgctgagaacgccaacgcaccaatgcaaggtgctt
acgcaaatcagccagtag

DBGET integrated database retrieval system