KEGG   Microbulbifer agarilyticus: Mag101_12285Help
Entry
Mag101_12285      CDS       T04709                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
maga  Microbulbifer agarilyticus
Brite
Enzymes [BR:maga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Mag101_12285
Peptidases [BR:maga01002]
 Metallo Peptidases
  Family M2
   Mag101_12285
Exosome [BR:maga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mag101_12285
CD molecules [BR:maga04090]
 Proteins
  Mag101_12285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Phage-MuB_C Tobravirus_2B
Motif
Other DBs
NCBI-ProteinID: AQQ69549
UniProt: A0A1Q2MA64
LinkDB All DBs
Position
complement(2936934..2938718)
Genome map
AA seq 594 aa AA seqDB search
MNIADSNGQPSAEDAKAFLDEAQARLEKMAQEASHASWVASTYINLDSQYTEALAMERYT
ALAVELAGEAAKFDNVDLDPETRRMLTMLKQGLVFPAPNDPEMTAELAQIGSKMQGMYGA
GKYCPEETAGLDPTVKKEGKCYTLTEMGQMMANSRDPKLLKDLWVGWRKVAPPMKPLYER
QVEIGNAGAKDLGYDNLSVMWRSKYDMPADEFSADMDNQWNKVKPLYEALHCHVRAKLNE
HYGDKVAPASGKIPAHLLGNMWAQEWGNVYDIVKDDDMEAPYDLTELVVNSGMTEQDMVK
TGEKFFTSLGFKPLPDTFWERSQFVQPKDRDVVCHASAWNLDNQDDIRIKMCINKTGEDL
ITVHHELGHNFYQRIYNQQPFLYKEGANDGFHEAVGDTIALSITPKYLKEIGLMDEIPGE
DKDLGYLMQQALDKIAFLPFGLLVDKWRWQVFNGEVAPGDYNKAWWQLREEYQGITPPVE
RSEANFDPGAKYHIPGNTPYARYFLARIQQFQFHRALCEAAGETGPLHRCSIYKNKAAGE
KLRNMLAMGASKPWPDAMEALTGERELDATAIVDYFQPLMVYLEEQNKDRDCGW
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgccgacagcaatgggcaaccgagtgcggaggatgccaaggcattcctcgat
gaagcccaggcccgtctggaaaaaatggctcaggaagctagccacgcgagctgggtagct
tctacttatatcaacctggattcccagtacaccgaagccctggcgatggagcgctatacc
gcacttgcggtcgaactggccggtgaggcagccaagttcgataatgtagatctcgatcct
gaaacccgccgcatgctgaccatgctcaaacagggcctggttttccccgccccgaatgat
cccgaaatgaccgcggaacttgcacaaattggttccaagatgcagggcatgtacggtgcc
ggcaagtactgccctgaggaaacggcgggactggatccgaccgttaagaaagaaggcaag
tgctacacccttacggaaatgggccagatgatggccaacagccgcgatccgaagttgctg
aaagatctctgggtgggttggcgcaaggttgcgccgccgatgaagccactctacgaacgt
caggttgagatcggtaatgccggtgccaaggacctgggctatgacaatctcagcgtcatg
tggcgctccaaatacgatatgcctgcggacgaattttctgcggacatggataaccagtgg
aacaaggttaagcccctgtatgaggcgctccattgccacgtgcgtgcaaaactgaatgag
cactatggcgataaagtagcgccggcgagtggcaaaattcctgcgcacttgctcggtaat
atgtgggcgcaggagtggggcaacgtttacgatatcgtcaaagatgacgatatggaggcg
ccctacgatctcaccgagctggtggtgaattccggcatgacggaacaggatatggtgaag
accggcgagaagttttttacttcactcggttttaaaccgctaccggataccttctgggag
cgctctcagtttgtccagccaaaagaccgcgacgtggtttgccatgcaagtgcctggaac
ctggataaccaggacgatatccgtatcaaaatgtgcatcaacaagaccggtgaagacctg
atcaccgtccaccacgagttggggcacaacttctaccaacgtatctacaaccagcagccg
ttcctgtacaaagaaggtgccaatgacggcttccacgaggcggtgggggataccattgcg
ctatctatcacgcccaagtatctgaaagaaatcggcctgatggacgagattcccggcgaa
gacaaggatctcggttatctgatgcagcaggcgttggataaaattgcattcttgccgttc
ggtttactggtggataagtggcgttggcaggtgttcaacggtgaagttgccccgggtgat
tacaacaaggcgtggtggcaactgcgcgaagagtatcagggtattaccccgccggtagag
cgcagcgaagcgaacttcgatccgggcgccaagtatcacatcccaggaaacacaccatac
gcccgctactttttagcgcgtattcaacagttccaattccatcgcgcgctctgcgaggcc
gctggcgaaaccgggccgctgcaccgctgttccatttacaaaaacaaggcggccggtgaa
aagttgcgtaacatgttggctatgggtgcaagcaaaccgtggccggatgccatggaggcg
ctcaccggtgagcgcgagctggatgctacggcgattgtggattatttccaaccgctgatg
gtgtatctggaagagcaaaataaagatcgcgactgtggttggtaa

DBGET integrated database retrieval system