KEGG   Microbulbifer agarilyticus: Mag101_16035Help
Entry
Mag101_16035      CDS       T04709                                 

Definition
(GenBank) class C beta-lactamase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga01501  beta-Lactam resistance
maga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mag101_16035
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Mag101_16035
Enzymes [BR:maga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     Mag101_16035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AQQ68973
UniProt: A0A1Q2M8B6
LinkDB All DBs
Position
complement(3861033..3862247)
Genome map
AA seq 404 aa AA seqDB search
MSLSLFTSRSLKSLVAGAGVILGGMANAESGVKISADQLEAAVVEAIQPVVEKYQVPGMA
LALTIDGEAHFFNLGETALEDGAPITEHTLFEVGSVSKTFTATLAAYAEVKGALDFAKPV
STYLPPLRGSAMDRVSVLNLATHTAGHFPLQVPSEVQDEEQLLSYFRDWQPQYSPGSKRT
YSNPGSGLLGLVAARSLNQPFAEAMDQHIFRGLGLSETYVQVPAEKMLDYAEGHNRRHEP
VRVNMGLLGEEAYGVRASAADLTRYIAAQMQLVKVDEDLQRALEKTRSGYFSTKYYVQDM
VWEQYALPLERTRLLAGNNWKNINGDRPVDAIQPPMAPQQNVLINKTGSTGGFSTYVAFI
PQQRFGFVMLANKYFPNQARVEMLYALLQSLLPAVVAEPADATE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctctctgtttacttcacgctcgctgaagagtctggttgccggtgccggcgtt
atcctgggaggtatggcgaacgcagagtctggcgtgaaaattagcgcggatcagctggaa
gccgcagtggtcgaagcgattcagcccgtggtggagaaatatcaggtgccaggtatggcg
ctggccctcaccatcgatggcgaagcgcactttttcaacttgggagaaaccgcgctggag
gatggcgcgccaataaccgagcacacactgttcgaggtggggtcggtcagcaagaccttt
accgccacactggcagcatacgcagaagtcaaaggggcactggattttgccaagcctgtg
agcacttacctgccgccgctgcgcggcagtgccatggatcgcgtatcggtactcaatctc
gccacccacaccgctgggcacttcccgctacaggttccatcggaggtgcaggacgaggaa
cagttgctcagttattttcgcgactggcaaccgcagtacagccccggcagcaaacggacg
tattccaatccgggtagcggcctgctgggcctggttgccgcacgcagcctgaaccagccg
tttgccgaggcaatggatcagcatatttttcgtggcctgggtttgtctgagacctacgtg
caggtccctgctgaaaaaatgctggattacgccgaggggcacaatcggcgacacgagccg
gtgcgggtaaatatgggcctgctcggtgaagaggcctatggcgtgcgcgccagtgccgca
gatttgacccgctatattgccgcgcagatgcaactggtgaaggtcgatgaagacctgcaa
cgggcactggaaaaaacgcgcagcggttatttcagcaccaagtattacgtgcaggatatg
gtttgggagcagtatgccctgccgctggaacgaacccggctgctcgcgggcaacaactgg
aagaacatcaacggcgaccggccggtagatgcaatccagccgcccatggcgccacagcaa
aatgtgctgattaacaagacggggtccaccgggggcttttccacctatgttgcgtttatt
ccccagcagcggtttggttttgtgatgctggcgaataaatactttcccaatcaggcacgc
gtcgagatgctgtatgccctgttgcagtcgctgctgcccgcggttgtggcagaacccgct
gatgctacagaataa

DBGET integrated database retrieval system