KEGG   Microbulbifer agarilyticus: Mag101_17075Help
Entry
Mag101_17075      CDS       T04709                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
maga  Microbulbifer agarilyticus
Pathway
maga00620  Pyruvate metabolism
maga01100  Metabolic pathways
maga01120  Microbial metabolism in diverse environments
maga01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:maga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mag101_17075
Enzymes [BR:maga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Mag101_17075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog AlaDh_PNT_C Malate_DH ThiF
Motif
Other DBs
NCBI-ProteinID: AQQ69656
UniProt: A0A1Q2MAE4
LinkDB All DBs
Position
4099315..4100568
Genome map
AA seq 417 aa AA seqDB search
MTDSLRQAALDYHALPTPGKLSVELTTPAETQEDLSLAYSPGVAEPVREIAKDPEAAYRY
TGKGNLVAVISNGTAILGLGNLGPLASKPVMEGKSLLFKRFADINSVDIEVEAPSPERFI
ETVAAIANTFGGINLEDIKAPECFQIEEALIQRCSVPIFHDDQHGTAIVTVAGMLNALEI
QGKNIEDARIVCLGAGAAATACCKLLLCAGAKKEQITMLDSRGVIHSGRSDINAYKGEWA
RDTEMRTLDDAIEGADVFLGVSGPDLLSADQLAHMADKPVVFACSNPNPEIAPELAHATR
DDLIMATGRSDYPNQVNNVLCFPFIFRGALDVRATSINEHMKLAAIEAIRKLAREEVPEE
VRAGYGGVEMAFGPSYILPKPTDPRLLPEVAAAVAKAAVDSGAARLPYPEHYPLKPL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactctctacgccaggcagcgctcgattaccatgccttgccgacaccgggcaaa
ttatcggtggaactcaccacacctgcagaaacccaggaagacctctccctcgcctacagc
ccgggagtagcggagccggtgcgcgaaatcgccaaagatccggaagccgcctaccgctat
accggcaagggcaacctggtggcggtcatctccaacggcaccgccatcctcggcctcggc
aacttgggcccactggcctccaagccggtgatggagggcaagtcgctgctgtttaaacgt
tttgcggatatcaattctgtggatattgaagtggaagcaccgagccccgagcggtttatc
gaaaccgttgcggctatcgccaacaccttcggcggcatcaacctcgaagacatcaaggcg
ccggagtgcttccagatcgaagaggcactgatccagcgctgttcggtacccattttccac
gacgatcagcacggcaccgcgattgtgaccgttgccggcatgttgaacgcactggaaatc
caggggaaaaacatcgaagacgcgcgcatcgtgtgtttgggcgccggcgccgccgccact
gcctgctgcaagctactgttgtgcgcgggtgccaaaaaagagcagatcactatgctcgac
agccgcggggttattcactccggacgcagtgatatcaacgcctacaagggtgagtgggca
cgggataccgaaatgcgcaccctggatgacgccattgagggtgccgatgtattcctcggc
gtgtccggcccagacctgctgtctgcggatcagctggcgcacatggccgacaagccggtg
gtgtttgcctgctccaaccccaatccggaaatcgccccggagctggcgcacgcaacccgc
gacgacctgatcatggccaccggccgctcggactacccgaaccaggtaaacaacgtcctg
tgcttcccgtttatcttccgcggtgcactggacgtgcgcgctaccagtatcaacgagcac
atgaaactcgcggccatcgaggcaatccgcaagctggcgcgggaagaagtgccggaagag
gtgcgcgcgggctacggtggtgtggaaatggcattcggcccctcctacatcttgccgaaa
cctaccgacccccgcctgctgccggaagtggccgcagcggtggccaaggctgcggtagat
agcggtgccgcgcgcctgccctacccggagcattacccgcttaagccgttgtag

DBGET integrated database retrieval system