KEGG   Magnetospirillum sp. ME-1: WV31_00760Help
Entry
WV31_00760        CDS       T04817                                 

Definition
(GenBank) nif-specific transcriptional activator NifA
  KO
K02584  Nif-specific regulatory protein
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:magn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WV31_00760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:magn03000]
    WV31_00760
Transcription factors [BR:magn03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    WV31_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 GAF AAA_5 GAF_2 AAA Mg_chelatase AAA_2 GAF_3 AAA_16 FAP
Motif
Other DBs
NCBI-ProteinID: ARJ64329
UniProt: A0A1W6CHP8
LinkDB All DBs
Position
217271..218950
Genome map
AA seq 559 aa AA seqDB search
MRMTAQKSDESALPLIGIYEISKILGATLDLDKALHDVLNVLSSYLNMRHGAVVLKDDSG
KPHLSAVTGMSLRLAREGVLKYPFAAVDKVIATGIPMVVPDAAEEPLLAEYMAENDDTLE
DERLSFFCVPVKTTDKPFGALSVERSWDGGAQYVFEHDLRFLTMVATLIGQTASLHRKLA
NDRETLMTDAARLQKRMAEVRPVLPIRGLEDVVGNSEAMARVFAQVQQAAPTKATILLRG
ESGTGKELVARAVHVLSARAQKPFIKVNCAALSESVLESELFGHEKGAFTGAVAERKGRF
ELSTGGTLFLDEIGEISANFQAKLLRVLQEGEFERVGGNKTVKVDVRLIAATNRDLEAGV
ADGSFRADLYYRLNVVPIFLPPLRERSGDIPLLAMYFLKQFNEENGRAMAFSHGALEALQ
RCYFPGNVRELENCVYRTATMTKGEVIDEMDLSCKHDTCLSSTLWHKRNPGDKAAPTLSA
PIPVPTGPLSMPPPAAPPAPAPPVVEPASGDEDLSERDRLVQAMERCGWVQAKAARLLGL
TPRQIGYALKKHNIEIRQL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatgacggcccagaagagtgacgaaagcgccctgccgctgatcggcatctacgag
atcagcaagattctcggcgccaccctcgacctcgacaaggcgctccacgacgtcctcaac
gtgctgtcctcctatctcaacatgcgccacggcgccgtggtgctgaaggacgattccggc
aagccgcacctgtccgccgtcaccggcatgtcgctgcgcctggcgcgcgaaggcgtgctg
aaatatcccttcgcggcggtggacaaggtgatcgccaccggcattcccatggtggtgccc
gacgccgccgaggaacccttgctggccgagtacatggccgagaacgacgacaccctggaa
gacgagcgcctctcgttcttctgcgtcccggtcaagaccaccgacaagccgttcggggcg
ctttcggtggagcgttcgtgggacggcggcgcccagtacgtgttcgagcacgacctgcgc
ttcctcaccatggtcgccaccctgatcggccagaccgccagcctgcaccgcaagctggcc
aacgaccgcgaaaccctgatgaccgacgcggcccggctgcaaaagcgcatggccgaggtc
cgccccgtcctgcccatccggggattggaggacgtggtcggcaattccgaggccatggcc
cgggtcttcgcccaggtgcagcaggcggcgccgaccaaggccaccatcctgctgcgcggc
gaaagcggcaccggcaaggaactggtggcgcgcgccgtccacgtgctgtcggcccgcgcc
cagaagcccttcatcaaggtcaattgcgccgccctgtcggaaagcgtgctggaatccgag
ctgttcggccacgagaagggcgccttcaccggcgcggtggccgagcgcaagggccgcttc
gagctgtccaccggcggcaccctgttcctcgacgagatcggcgagatctccgccaacttc
caggccaagctgctgcgcgtgctgcaggaaggcgagttcgagcgggtcggcggcaacaag
accgtcaaggtcgacgtccgcctgatcgccgccaccaaccgcgacctggaagcgggcgtc
gccgacggctcgttccgcgccgacctctattatcgcctcaacgtggtgcccatcttcctg
ccgccgctgcgcgagcgctcgggcgacatcccgctgctggccatgtacttcctcaagcag
ttcaacgaggagaacggccgcgccatggccttctcccacggcgccctggaggcgctgcag
cgatgttatttccccggcaacgtgcgcgagctggagaactgcgtctaccgcaccgccacc
atgaccaagggcgaggtcatcgacgagatggacctgtcgtgcaagcacgacacctgcctg
tcgtccaccctgtggcacaagcgcaatcccggcgacaaggccgcccccacattgagcgcc
cccattccggtgcccaccggccccctgtccatgccgccgcccgccgcgccgccggccccg
gccccgccggtcgtcgagcccgcctccggcgacgaggacctgtcggaacgcgaccgcctg
gtccaggccatggagcgctgcggctgggtccaggccaaggccgcccgcctgctgggcctg
acgccgcgccagatcggctacgccctgaagaagcacaacatcgagatccggcaactgtga

DBGET integrated database retrieval system