KEGG   Magnetospirillum sp. ME-1: WV31_03140Help
Entry
WV31_03140        CDS       T04817                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00910  Nitrogen metabolism
magn02010  ABC transporters
Module
magn_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    WV31_03140
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WV31_03140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:magn02000]
    WV31_03140
Transporters [BR:magn02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    WV31_03140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ARJ64737
UniProt: A0A1W6CIQ3
LinkDB All DBs
Position
721970..722830
Genome map
AA seq 286 aa AA seqDB search
MTMATNPVGVTPDTTKATAYKPVVPVSAAARKAKEVAGRVLPPMIGLAVVLGIWQLACSG
PGAMLPGPAKVVHDTWGLIADPFFDRGGVDKGLFWHLFASLKRVAVGFALSSLAGIFLGV
LIGQSTMAYRALDPIFQVLRTVPPLAWLPISLAAFRQADPSAIFVIFITSVWPIILNTAV
GVRNIPQDYRNVAAVLRLSPIEFFFKIVIPATVPYIFTGLKIGIGLSWLAIVAAEMLIGG
VGIGFFIWDAWNSSLMSEIILALIYVGLVGFMLDRMITFVGQKFSS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggctaccaatcccgtcggcgtgacccccgacaccaccaaggccaccgcgtac
aagcccgtcgtcccggtcagcgccgccgccaggaaggcgaaggaggtggccggccgcgtc
ctgccgcccatgatcgggctggcggtggtgctgggcatctggcaactggcctgttccggc
cccggcgccatgctgcccggcccggccaaggtggtgcacgatacctggggcctgatcgcc
gatccgttcttcgatcgcggcggcgtggacaagggcctgttctggcacctgttcgcctcc
ttgaagcgtgtcgcggtgggcttcgccctgtcctccctggccggcatctttctcggcgtg
ctgatcggccagagcaccatggcctaccgggcgctggaccccatcttccaggtgttgcgc
accgtgccgccgctggcctggctgcccatctcgctggccgccttccgccaggccgacccg
tccgccatcttcgtgatcttcatcacctcggtgtggccgatcatcctcaacaccgccgtc
ggcgtgcgcaacatcccccaggattaccgcaacgtcgccgccgtgctgcgcctgtcgccc
atcgagttcttcttcaagatcgtcatccccgccactgtgccttacatcttcaccggcctg
aagatcggcatcggcctgtcgtggctggccatcgtggcggccgagatgctgatcggcggc
gtgggcatcggcttcttcatctgggacgcctggaacagctcgctgatgagcgagatcatc
ctggccctgatctatgtcggcctggtgggcttcatgctggaccgcatgatcaccttcgtc
ggccagaaattctcgagctag

DBGET integrated database retrieval system