KEGG   Magnetospirillum sp. ME-1: WV31_06935Help
Entry
WV31_06935        CDS       T04817                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
magn  Magnetospirillum sp. ME-1
Brite
Enzymes [BR:magn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     WV31_06935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARJ65408
UniProt: A0A1W6CKM9
LinkDB All DBs
Position
complement(1533581..1534177)
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPFAIDALEPHISARTFEFHHGKHHAAYVTNLNNLTKDTDLASKSLEEVIKVA
AADLPAKQGIFNNAAQVWNHTFFWNCMKKGGGGKPGAKLLARIESDLGGFDKFKEDFKAA
AVGQFGSGWAWLVLDAGKLKITKTANADLPMAHGQKALLTVDVWEHAYYLDWQNRRPDFV
QCFLDNLVNWDFVEANLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgagcttccgccgctccccttcgccatcgacgcgctggagccgcacatttcc
gcccgcaccttcgagttccatcacggcaagcatcacgccgcctatgtgaccaacctcaac
aacctgaccaaggacaccgatctggcgtccaagtccctggaagaggtgatcaaggtggcg
gctgccgatctgccggccaagcagggcatcttcaacaatgccgcccaggtgtggaaccac
accttcttctggaactgcatgaagaagggcggcggcggcaagccgggggcgaagctgctg
gccaggatcgagtccgatctgggcgggttcgacaagttcaaggaagacttcaaggccgcc
gccgtgggccagttcggctcgggctgggcctggctggtgcttgatgccggcaagctgaag
atcaccaagacggccaatgccgacctgcccatggcccacggccagaaggcgctgctcacc
gtcgacgtgtgggagcatgcctattacctcgactggcagaaccgccgtcccgacttcgtc
cagtgcttcctggacaatctggtgaactgggatttcgtcgaagccaatctgggctga

DBGET integrated database retrieval system