KEGG   Magnetospirillum sp. ME-1: WV31_15090Help
Entry
WV31_15090        CDS       T04817                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00020  Citrate cycle (TCA cycle)
magn00190  Oxidative phosphorylation
magn00650  Butanoate metabolism
magn01100  Metabolic pathways
magn01110  Biosynthesis of secondary metabolites
magn01120  Microbial metabolism in diverse environments
magn01130  Biosynthesis of antibiotics
magn01200  Carbon metabolism
Module
magn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
magn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
magn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WV31_15090
   00650 Butanoate metabolism
    WV31_15090
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    WV31_15090
Enzymes [BR:magn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     WV31_15090
    1.3.5.4  fumarate reductase (quinol)
     WV31_15090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ARJ66903
UniProt: A0A1W6CPW0
LinkDB All DBs
Position
complement(3249940..3250719)
Genome map
AA seq 259 aa AA seqDB search
MVEFALPANSRVQPGKVYKATGAKNVKVFKIYRYDPDSNANPRLDSYEVDLDACGPMVLD
ALLKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACLKPIEDIKGDAAIYPLPHMPV
VKDLIPDLTLPYAQLASIKPWMQTQTAPPPDGERLQSPEEREKLDGLWECILCFCCQTSC
PSYWWNGDRYLGPSVLLQAARWILDTRDEMTGERLDALEDPFKLYRCHTIMNCTKTCPKG
LNPAKAIGAIKEKIAERRL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattcgccctgcccgccaactcgcgggtccagcccggcaaggtctacaaggcc
actggcgccaagaacgtcaaggtcttcaagatctaccgctacgaccccgattccaacgcc
aacccgcggctcgacagctacgaggtcgacctcgacgcctgtggccccatggttctggac
gccctgttgaagatcaagaacgagatcgactcgaccttgaccttccgccgctcgtgccgc
gaaggcatctgcggttcgtgcgccatgaacatcgacggcaccaacacgctggcctgcctc
aagcccatcgaggacatcaaaggcgacgcggccatctatccgctgccgcacatgccggtg
gtcaaggacctgatccccgacctgaccctgccctatgcccagctggcctccatcaagccc
tggatgcagacccagaccgccccgccgccggacggcgagcgcctgcagagcccggaagag
cgcgagaagctcgacggcctgtgggaatgcatcctgtgcttctgctgccagaccagctgc
cccagctactggtggaacggcgaccgctatctcggcccgtcggtgctgttgcaggccgcc
cgctggattctcgacacccgcgacgagatgaccggcgagcgtctggacgcgcttgaagac
cccttcaagctgtaccgctgccacaccatcatgaactgcaccaagacctgccccaaggga
ctcaatcccgccaaggccatcggtgccatcaaggaaaagatcgccgagcgccgcctctaa

DBGET integrated database retrieval system