KEGG   Magnetospirillum sp. ME-1: WV31_15095Help
Entry
WV31_15095        CDS       T04817                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00020  Citrate cycle (TCA cycle)
magn00190  Oxidative phosphorylation
magn00650  Butanoate metabolism
magn01100  Metabolic pathways
magn01110  Biosynthesis of secondary metabolites
magn01120  Microbial metabolism in diverse environments
magn01130  Biosynthesis of antibiotics
magn01200  Carbon metabolism
Module
magn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
magn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
magn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WV31_15095
   00650 Butanoate metabolism
    WV31_15095
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    WV31_15095
Enzymes [BR:magn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     WV31_15095
    1.3.5.4  fumarate reductase (quinol)
     WV31_15095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ARJ66904
UniProt: A0A1W6CPY0
LinkDB All DBs
Position
complement(3250741..3252525)
Genome map
AA seq 594 aa AA seqDB search
MAAYKIIDHTYDVVVVGAGGAGLRATMGMGQAGFKTACITKVFPTRSHTVAAQGGIGASL
GNMAEDTWQWHMYDTVKGSDWLGDQDAIEYMCREAVPAVHELEHFGVPFSRTPEGKIYQR
PFGGHMSNFGEKPVQRACAAADRTGHAILHTLYSQCLKHQCEFFIEYFALDLIMDADGTC
RGVMAWNLDDGTLHRFRAHQVVLASGGYGRAYFSCTSAHTCTGDGHGMVTRAGLPLQDME
FVQFHPTGMYGSGCLITEGARGEGGYLTNSAGERFMERYAPTAKDLASRDVVSRAMTMEI
REGRGVGKDKDHIFLHLEHLGAETLELRLPGITETAKIFTGVDVTKAPAPVLPTVHYNMG
GIPTNLHGEVLRPTKDNPDATVQGLMAIGEAACVSVHGANRLGTNSLLDIVVFGRAAALH
AAKILKPGTPHKPLPKDGSDLAVSRFDRLRNASGSMHTSEIRLAMQKTMQNDAAVFRTSK
SLAEGCEKMGQVASTLPQIKINDRSTVWNSDLVEALELENLMDCALATIVGAEARHESRG
AHAHEDFPERDDVEWQKHTLATVKDGKVTLDYRPVHTYTLTDEVEYIKPQKRVY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctacaagattatcgaccacacctacgacgtggtggttgtcggtgccggcggc
gccggcctgcgcgccaccatgggcatgggtcaggccggcttcaagaccgcctgcatcacc
aaggtgttccccacccgctcgcacaccgtggccgcccagggcggcatcggcgcctcgctc
ggcaacatggccgaggacacctggcagtggcacatgtacgacaccgtcaaggggtcggac
tggctgggcgaccaggacgccatcgagtacatgtgccgcgaggccgtgccggccgtgcat
gagctcgagcatttcggtgtgcccttctcgcgcactccggaaggcaagatctaccagcgt
ccgttcggcggccacatgtccaatttcggcgagaagccggtgcagcgcgcctgcgccgcc
gccgaccgcaccggacacgccatcctgcacacgctgtactcccagtgcctgaagcaccag
tgcgagttcttcatcgagtacttcgcgctcgacctgatcatggatgccgacggcacctgc
cgcggcgtgatggcctggaacctggacgacggcacgctccaccgcttccgcgcccatcag
gtggtgctggcctcgggcggctatggccgcgcctacttctcgtgcacctcggcccacacc
tgcaccggcgacggccacggcatggtgacccgcgccggcctgccgctgcaggacatggag
ttcgtgcagttccaccccaccggcatgtacggttcgggctgcctgatcaccgagggcgcc
cgcggtgaaggcggctacctgaccaactccgccggcgagcgcttcatggagcgttacgcc
cccaccgccaaggacctggcgtcccgcgacgtggtgtcgcgcgccatgaccatggaaatc
cgcgaaggccgcggcgtgggcaaggacaaggaccacatcttcctgcatctcgagcacctg
ggtgccgagaccctggaactgcgcctgcccggcatcaccgagaccgccaagatcttcacc
ggcgtcgacgtgaccaaggcccccgccccggttctgcccaccgtccactacaacatgggc
ggcatccccaccaacctgcacggcgaagtgctgcgtcccaccaaggacaatcccgacgcc
acggtgcagggcctgatggccatcggcgaggccgcctgcgtgtcggtgcacggcgccaac
cgcctgggcaccaactcgctcttggacatcgtggtgttcggccgcgccgccgcgctgcac
gccgccaagatcctcaagcccggcacgccgcacaagccgctgcccaaggatggctcggat
ctggccgtgtcgcgcttcgaccgtctgcgcaacgcctcgggttccatgcataccagcgag
atccgcctggccatgcagaagaccatgcagaacgacgccgcggtgttccgcacctcgaag
tcgctggccgagggctgcgagaagatgggccaggtggcctccaccctgccgcagatcaag
atcaacgaccgctccaccgtgtggaactcggacctggtcgaggctctcgagctcgagaac
ctgatggattgcgcgctggccaccatcgtcggcgccgaagcccgccacgaaagccgcggc
gcccatgcgcacgaggacttccccgagcgtgacgacgtcgaatggcagaagcacaccctg
gccaccgtcaaggacggcaaggtgaccctggactaccgtccggtgcacacctacacgctg
accgacgaggtcgagtacatcaagccgcaaaagcgcgtgtactga

DBGET integrated database retrieval system