KEGG   Magnetospirillum sp. ME-1: WV31_18130Help
Entry
WV31_18130        CDS       T04817                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
magn  Magnetospirillum sp. ME-1
Brite
KEGG Orthology (KO) [BR:magn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:magn03012]
    WV31_18130
   03029 Mitochondrial biogenesis [BR:magn03029]
    WV31_18130
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:magn04147]
    WV31_18130
Translation factors [BR:magn03012]
 Eukaryotic Type
  Elongation factors
   WV31_18130
 Prokaryotic Type
   WV31_18130
Mitochondrial biogenesis [BR:magn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    WV31_18130
Exosome [BR:magn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   WV31_18130
  Exosomal proteins of breast cancer cells
   WV31_18130
  Exosomal proteins of colorectal cancer cells
   WV31_18130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ARJ67443
UniProt: A0A1W6CRF5
LinkDB All DBs
Position
3937736..3938926
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKILAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKCDMVDDPELLDLVELEVRELLSSYDFPGDDIPIVKGSALCALE
DKQPEIGRDAILKLMAEVDAYIPQPERPKDKPFLMPIEDVFSISGRGTVVTGRVERGVVK
VGEEVEIVGIKATVKTTCTGVEMFRKLLDQGEAGDNIGALLRGTKREDVERGQVLAAPGS
ITPHTKFEAEAYVLTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVELPEGTEMVMPGDNVK
MHVTLIAPIAMDQGLRFAIREGGRTVGAGVVAKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggctaaattcgagcgcaccaagcctcactgcaacatcgggaccatcggtcac
gttgaccatggcaagacctcgctgaccgcggcgatcaccaagatcctggccgagaccggc
ggcgccaccttcaccgcctacgaccagatcgacaaggcgccggaagagaaggcccgtggc
atcaccatctcgaccgcccacgtcgagtacgagaccaccaaccgccactacgcccacgtg
gactgccccggccacgccgactatgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgccatcctggtggtgtcggccgccgacggccccatgccccagacccgcgagcacatc
ctgctggcccgtcaggtgggcgtgcccgccctggtggtgttcatgaacaagtgcgacatg
gtcgacgatcccgagctgctggatctggtcgagctggaagtgcgcgagctgctctcctcg
tacgacttccccggcgacgacattccgatcgtcaagggttcggccctgtgcgccctggaa
gacaagcagccggagatcggccgcgacgccatcctgaagctgatggccgaggtcgacgcc
tacatcccgcagccggagcgtcccaaggacaagccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgcgtcgagcgtggcgttgtgaag
gtgggcgaggaagtcgagatcgtcggcatcaaggcgaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctcgatcagggtgaggccggcgacaacatcggcgccctg
ctgcgcggcaccaagcgcgaggacgtggagcgcggccaggttctggcggctccgggctcc
atcacgccgcacaccaagttcgaggccgaggcctacgttctgaccaaggaagagggcggc
cgtcacactccgttcttcaccaactatcgtccgcagttctacttccgcaccaccgacgtc
accggcgtcgttgaactgccggaaggcaccgagatggtgatgccgggcgacaacgtgaag
atgcacgtgaccctgatcgcccccatcgccatggaccagggcctgcgcttcgccatccgc
gaaggcggccgtaccgtcggcgccggcgtggtcgccaagatcgtcgagtaa

DBGET integrated database retrieval system