KEGG   Magnetospirillum sp. ME-1: WV31_18645Help
Entry
WV31_18645        CDS       T04817                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
magn  Magnetospirillum sp. ME-1
Pathway
magn00030  Pentose phosphate pathway
magn01100  Metabolic pathways
magn01120  Microbial metabolism in diverse environments
magn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:magn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    WV31_18645
Enzymes [BR:magn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     WV31_18645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ARJ67531
UniProt: A0A1W6CRR5
LinkDB All DBs
Position
complement(4043531..4045381)
Genome map
AA seq 616 aa AA seqDB search
MSWTGKFLRVDLSKGTVKAEELNREWTRQYLGQRGLATKYFTEEVDPKVDPLSPANKLIF
TTGPLTGTAASTGGRYSVVTKGPLTGCIACSNSGGFFGNELKNAGWDMIIVEGRSPKPVY
LSVENETVEIRDASDFWGKTVWETENGLKARHQDPMLRVASIGAAGEKGVLYACIVNDLH
RAAGRSGVGAVMGSKHLKAVAVRGTRGVTVKDPDRFIKAATEQKKVLADNAVTGQGLPKY
GTQVLMNVINEIGAMPTRNSRDVQFEGAHKISAEAMHEPRLSDGKTNLATNGACFGCTIA
CGRISRMDPGHFSIASRPQYKEPSGGLEYEAAWALGSACGVDDIEACTFANFMCNEHGID
PISFGSTLAAAMELYEMGVLTKEQTGGIDLKFGSAEALVKAAELTGKGEGFGLELGQGSR
RLTAKYGQPDLSMTVKGQEFPAYDPRGIQGMGLTYATSNRGACHLRSYTVASEVLGIPFK
TDPLATEGKAGLVKAFQDATAAFDASGICIFTTFAWSLENLAPQLDAACEGSWTPEVLLE
VGERIWTLERQFNLAAGMTAADDTLPKRLLKDAAKTGPAKGLASGLDKMLPEYYQLRGWT
PDGVPTAETLKRLHLA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagctggaccggcaagtttctccgcgtcgatctttccaagggcaccgtcaaggccgag
gagctgaaccgcgagtggacgcggcagtacctgggccagcgcggactggccaccaagtac
ttcaccgaggaggtcgatcccaaggtcgatcccctgtcgcccgccaacaagctgatcttc
accaccgggccgctgacggggaccgccgcctccaccggcgggcgctattccgtggtgacc
aaggggccgctgacgggctgcatcgcctgctccaattccggcggcttcttcggcaacgag
ctgaagaacgccggctgggacatgatcatcgtcgagggccgctcgcccaagcccgtctac
ctctcggtcgagaacgagaccgtggagatccgcgacgcctcggacttctggggcaagacg
gtgtgggagaccgagaacggcctgaaggcccggcaccaggaccccatgctgcgcgtcgcc
tccatcggcgccgccggcgagaagggcgtgctctacgcctgcatcgtcaacgacctgcac
cgcgccgccgggcgctcgggcgtcggcgcggtgatgggctccaagcacctgaaggccgtc
gcggtgcgcggcaccaggggcgtcaccgtcaaggaccccgaccgcttcatcaaggccgcc
accgagcagaagaaggtgctggccgacaacgccgtcaccggccagggcctgcccaaatac
ggcacccaggtgctgatgaacgtcatcaacgagatcggcgccatgccgacccgcaattcc
cgcgacgtgcagttcgagggcgcccacaagatctcggccgaggccatgcacgagccgcgg
ctttccgatggcaagaccaacctggccaccaacggcgcctgcttcggctgcaccatcgcc
tgcggccgcatctcgcgcatggatcccggccacttctccatcgcgtcgcggccccagtac
aaggagccctcgggcggcctggaatacgaggcggcctgggcgctgggctcggcctgcggc
gtggacgacatcgaggcctgcaccttcgccaacttcatgtgcaacgagcacggcatcgac
cccatttccttcggctcgaccctggcggcggccatggaactgtacgagatgggcgtgctg
accaaggagcagaccggcggcatcgacctgaaattcggctcggccgaggccctggtcaag
gcggccgagctgaccggcaagggcgagggcttcggcctggaactgggccagggctccagg
cggctgaccgccaaatacggacagcccgacctgtccatgacggtcaagggccaggaattc
cccgcctatgatccgcgcggcatccagggcatggggctgacctacgccacctccaatcgc
ggcgcctgtcacctgcgctcctataccgtggcgtcggaagtgctgggcattcccttcaag
accgatcccctggccaccgagggcaaggcgggcctggtcaaggcgttccaggacgccacc
gcggccttcgacgcgtcgggcatctgcatcttcaccaccttcgcctggagcctggagaat
ctggccccccagctggacgccgcctgcgaaggaagctggacgcccgaagtcctgctggag
gtgggcgagcgcatctggacgctggaacgccagttcaatctggcggccggcatgacggcc
gccgacgacaccctgcccaagcgccttttgaaggacgcggccaagaccggcccggccaag
gggctggcctccgggctcgacaagatgctgcccgaatactaccagctgcgcggctggacg
ccggacggcgtgcccaccgccgaaaccctgaagcgcctgcatctggcttga

DBGET integrated database retrieval system