KEGG   Magnetospira sp. QH-2: MGMAQ_0848Help
Entry
MGMAQ_0848        CDS       T03795                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
magq  Magnetospira sp. QH-2
Pathway
magq00473  D-Alanine metabolism
magq01100  Metabolic pathways
magq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:magq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGMAQ_0848 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MGMAQ_0848 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    MGMAQ_0848 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:magq01011]
    MGMAQ_0848 (ddl)
Enzymes [BR:magq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MGMAQ_0848 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:magq01011]
 Precursor biosynthesis
  Amino acid ligase
   MGMAQ_0848 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST ATP-grasp Chor_lyase GSP_synth
Motif
Other DBs
NCBI-ProteinID: CCQ72801
UniProt: W6KGY9
LinkDB All DBs
Position
complement(829770..830681)
Genome map
AA seq 303 aa AA seqDB search
MSENRHVAVLMGGWSAEREVSMVSGAAVTRALQKAGYQPTPIDVQRDMGSWLTRLFPRPV
AVFNALHGRFGEDGCVQGLLDILAIPYTHSGLLASALAMDKPMAKKMFAQAGIKVAEDII
VTRDDLLAGDPLPRPYVVKPINEGSSVGVYIIRESNNDNPFENDPWPFGETVMAEAFLPG
RELTVAVMGDRALGVTEILTDHEFYDYDAKYADGGSRHVVPADIPDSVAEEAMRLAVLAH
ETLGCRGVSRADFRYDGTHLTILEVNTQPGMTPTSLVPEQAAQAGISFPDLVGWMVENAE
YDG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacaggcatgtagccgtcttgatgggcggctggtcggcggagcgggaagtc
tccatggtcagcggcgccgccgtgacccgcgcccttcaaaaagccgggtaccaacccacc
cccatcgacgtccaacgggatatggggtcctggttgacccgcttgttcccccggccggtg
gcggtgttcaatgccttgcatgggcgcttcggcgaagatggctgtgttcagggcctgctc
gatatcctggccatcccctacacccattccggcctgctggcctcggccctggccatggac
aagccgatggccaagaaaatgtttgcccaggcaggcatcaaagtggccgaagacataatc
gtcacccgcgatgatctgttggccggtgacccgctgccccgtccctatgtggtcaagccg
atcaacgaagggtcttcggtcggcgtctatatcattcgcgagagcaacaacgacaacccg
ttcgagaacgacccctggccatttggcgaaacggtgatggccgaggccttcctgcccggt
cgggaactgaccgtggcggtgatgggcgatcgggctctgggcgtgaccgagatcctcacc
gaccatgaattctacgactatgacgccaagtatgccgatggcggatcgcgccatgtggtt
ccggcagacatccccgattcggtggcagaggaagccatgcgattggcggtgctggctcac
gaaaccctgggctgccgaggcgtatcgcgggccgatttccgttacgacggcacccacctg
accattctcgaagtcaatacccaaccgggcatgacccccacttccctggtcccggaacag
gctgctcaggcaggcatttcgttccctgatctagtgggctggatggtcgaaaacgcggag
tacgacggatga

DBGET integrated database retrieval system