KEGG   Magnetospira sp. QH-2: MGMAQ_0882Help
Entry
MGMAQ_0882        CDS       T03795                                 

Definition
(GenBank) putative DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
magq  Magnetospira sp. QH-2
Pathway
magq03030  DNA replication
magq03430  Mismatch repair
magq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:magq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MGMAQ_0882
   03430 Mismatch repair
    MGMAQ_0882
   03440 Homologous recombination
    MGMAQ_0882
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:magq03032]
    MGMAQ_0882
   03400 DNA repair and recombination proteins [BR:magq03400]
    MGMAQ_0882
Enzymes [BR:magq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MGMAQ_0882
DNA replication proteins [BR:magq03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MGMAQ_0882
DNA repair and recombination proteins [BR:magq03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     MGMAQ_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: CCQ72835
UniProt: W6K5I6
LinkDB All DBs
Position
872327..872776
Genome map
AA seq 149 aa AA seqDB search
MAEVAFYHLIAWPLERALPKLLERTVESGKRAVVIAGSDARVESLDMVLWTYEADSWLPH
GTSRMGHPANQPVWLTMQDENPNGAQFLFLTEGMTSDRLAEYERCFDLFDGNDPQAVQAA
RERWTACKAAGHDLAYWRQTDQGRWERQA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggtcgctttctaccacctgatcgcctggccgctggaacgggccttgccgaaa
ttgcttgagcggaccgtggagtccggcaagcgggcggtggtaatcgccgggtccgatgcc
agggtggaatccctggatatggtgctctggacctacgaggctgattcctggctgccccat
ggcacctctcgcatgggacatccggcgaatcagccggtatggctgaccatgcaggatgag
aaccccaacggggcgcagtttctgttcctgaccgaaggcatgacctcggatcgcctggcc
gaatacgagcggtgttttgatctgtttgatggcaatgatccacaagccgtgcaggcggcg
cgggagcgttggacagcctgcaaggccgccggtcacgatctcgcctattggcggcagaca
gatcaaggacggtgggagcggcaagcctaa

DBGET integrated database retrieval system