KEGG   Magnetospira sp. QH-2: MGMAQ_1983Help
Entry
MGMAQ_1983        CDS       T03795                                 

Definition
(GenBank) GH13 : candidate trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
magq  Magnetospira sp. QH-2
Pathway
magq00500  Starch and sucrose metabolism
magq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:magq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGMAQ_1983
Enzymes [BR:magq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MGMAQ_1983
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MGMAQ_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: CCQ73879
UniProt: W6KAA6
LinkDB All DBs
Position
2006268..2009558
Genome map
AA seq 1096 aa AA seqDB search
MQDSDPLWYKDAIIYQLHIKAYFDSNDDGMGDFAGLCEKLDYIADLGVTAIWVLPFYPSP
LRDDGYDIADYKNINPAYGSLRDFKLLVREAHKRDLKVITELVINHTSDQHPWFQRARKA
KPGSAARNYYVWSDDPTKYDGTRIIFCDTEPSNWTWDPVAGAYYWHRFFHHQPDLNFDNP
RVLEEVIKVMKHWLATGVDGLRLDAIPYLCEREGTNNENLPETHDILKKLRTWMNENYPD
RMFLGEANQWPEDVLPYFGDGDECHMAFHFPLMPRMYMALAQEDRHPITDIMRQTPDIPD
TCQWAIFLRNHDELTLEMVSDRERDYLWQYYAADTRARINMGIRRRLAPLLDNDRRKIEL
LNSLLMSMPGTPIIYYGDEIGMGDNIFLGDRNGVRTPMQWSPDRNAGFSKSDPQSLFLPP
IMDAVYGYEGVNVEAQSRSASSLLNWMKRLITVRKGHQVFGRGLLTFTYPGNRKVLAYLR
EFEDGSEVILCVANLSRAPQAVELDLRRFEGRIPIELIGRSPFPPIGNLPYFITLPAYGF
YWFVLAEETDAPAWHELPQEVMPLLDTLVWSTGWGDLLTRRGGQILTGHIMPKFLPMQRW
FAGKDQGVKDCRLVDHADLMGQDEDGYQITFYDVESDDGTVSRYLLPMAIVWEQTSGSAF
PLGLQAYGFAQVRRFNKIGMIYDALGGDRFNTRLMSALRAAEEIPTQNGGRLVFRPTELL
ADYPEKEDHFVRRLGREQSNTSIRIGEDMIFKVFRRIESGVHPELEMNRYLTEVAHYSNV
PPMLGSMELIDADGQPAALGILQAFIPNQGDGWTVTLEHLERYLEERALLPLEEQDDTSV
IESYRRYLLLAVTMGQRIAQLHLSLAQETEAPHFKPEPATDADQKKWLAKIRKQAEKAMA
ALIQARHHVDEEVSAQIDDLLAHWDKVVAPIDRGFSDNLTMSKTRIHGDLHLGQLVVIHE
DIHILDFEGEPARPLAERRAKNTPLRDVAGMIRSFDYAAWTVRFNLDDLALGGTPESQVA
WTDEWQRESVEAFTLAYQDTIGRCCSLPKNQRHFKRLLNLFILEKVLYEICYEASNRPDW
LRIPLQGLSKLISGRD
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacagcgaccccctctggtacaaagacgccatcatctatcaactgcacatcaaa
gcctattttgattccaatgatgacggcatgggcgactttgccgggctatgcgagaaactg
gactatattgccgatttgggcgtgacggccatttgggtcctgcccttctatccttcgcct
ctgcgcgatgatggctatgacatcgccgactacaagaacatcaatccggcctatggcagc
ctgcgcgacttcaaactgctcgtgcgtgaggcccacaaacgggatctgaaggtgatcacc
gagttggtcatcaatcacacctccgatcaacatccctggttccagcgcgcccgcaaggcc
aagcccggatcggcggcccgcaactactatgtctggagcgacgatccgaccaaatacgat
ggcacacggatcatcttttgcgataccgaaccatccaattggacctgggacccggtcgcc
ggggcttattattggcaccggttcttccaccatcagccggatctgaacttcgacaatccg
cgggtattggaagaagtcatcaaggtgatgaaacattggctggccaccggcgtggacggc
ttgcgattggacgccattccctatttgtgcgagcgcgagggcaccaacaacgagaacctg
cccgaaacccacgatatcttgaagaaattgcggacctggatgaacgagaactatcccgac
cgcatgtttctgggcgaggccaatcaatggccggaagacgtgctgccctactttggcgac
ggtgacgaatgccatatggcctttcacttccctttgatgccgcgcatgtacatggcgctg
gctcaggaagaccgtcacccgatcaccgatatcatgcgccagaccccggatatccccgat
acctgccagtgggccattttcttgcgcaatcacgatgaactgaccttggaaatggtcagt
gaccgggaacgggattacttgtggcagtactatgccgccgacacccgcgcgcgcatcaac
atgggcatccgccgccgcctagcccccctcttggacaacgaccggcgcaagatcgaactg
ctcaacagcctgctcatgtccatgcccggcacgcccatcatctattacggcgacgagatc
ggcatgggcgacaatatatttctgggtgatcgcaacggtgtgcggacccccatgcaatgg
tctccagaccgcaacgccggtttttccaagtccgatccgcaatccttgtttctgccaccg
atcatggacgcggtctatggctacgaaggcgtcaacgtggaggcccaaagccgcagtgcc
tcgtccttgctcaattggatgaagcggctgattaccgtgcgcaagggccatcaggtattc
ggtcgcgggctgctgaccttcacctaccccggcaatcgcaaggtcctggcttatttgcgc
gaattcgaggatggctcggaggtgatcctctgtgtggccaatctgtcccgcgcgccacag
gcggtggaattggatctgcgccggttcgagggccgaattcccattgaactgatcggtcgc
agccccttcccgcccatcggcaacctgccctatttcatcacccttcccgcctacggcttt
tattggtttgttttggccgaggagaccgacgcaccggcctggcacgaattgccgcaagaa
gtgatgcccttgttggacaccctggtctggtccaccggttggggggatcttctgacccgg
cgcggcggccagattctcaccggccatatcatgcccaaattcctgcccatgcagcggtgg
ttcgcgggcaaggatcaaggcgtcaaggactgccgtctggtggatcacgccgacctgatg
ggccaggacgaagacggctatcaaatcaccttctacgacgtggaatcggacgatggcacg
gtttcgcgctatctgctgcccatggccattgtttgggaacagacttccggctccgccttc
ccgcttggattgcaggcctatggctttgcccaggtgcggcggttcaacaagatcggcatg
atctatgatgctttggggggagaccgcttcaatacccgcttgatgagcgccttgcgcgcg
gcggaggaaatccccacccagaacggcggacgcctggttttccgccccacggagttgttg
gccgactacccggaaaaagaagatcactttgtgcgccgcctgggccgagagcaaagcaat
acttccatccgcattggcgaagacatgattttcaaggtcttccggcgcatcgaatcaggc
gtgcaccccgagttggaaatgaaccgctacctcaccgaagtcgcccactacagcaacgtt
ccccccatgctcgggtccatggaactcattgacgccgatggccagcccgccgcccttggc
attttgcaggccttcatccccaatcaaggggacggctggacagtcaccctggagcatctg
gaacgctacctggaagaacgtgccttgctgccgttggaagaacaggacgatacctcggtg
atcgagagctatcggcgctatcttctgcttgccgtcaccatgggccagcgcatcgcccaa
ttgcacctgtccctggcccaggaaacggaagccccccatttcaaacccgaaccggcgacc
gacgcggatcagaaaaaatggctggccaagatccgcaagcaggcggaaaaggccatggcg
gcgctgattcaggccagacatcacgtggatgaagaggtctcggcccaaatcgacgatctg
ctggcccattgggacaaagtggtggcgcccattgatcggggtttctccgacaatctcacc
atgtccaagacccgaatccatggcgatttgcacctgggtcaattagtggtcatccatgaa
gatatccacattctcgacttcgaaggcgaaccggcgcggcccctggccgaacggcgagcc
aagaatacccccttgcgcgacgtggcaggcatgatccgttccttcgactatgccgcttgg
accgtgcgcttcaatctcgacgatctggcattgggcggcaccccggaaagccaggtggcc
tggaccgacgaatggcagcgagaatcggtggaagccttcacgctggcctatcaagacacc
attggccgctgctgctcgctgcccaagaaccagcgtcacttcaagcgcctgctcaacttg
tttattctcgaaaaggtgctctacgaaatctgctacgaggcgtcgaaccgccctgactgg
ctgcgcatcccgttgcaggggctgagcaagctgatttcagggcgggattga

DBGET integrated database retrieval system