KEGG   Magnetospira sp. QH-2: MGMAQ_2468Help
Entry
MGMAQ_2468        CDS       T03795                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, iron/manganese cofactor
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
magq  Magnetospira sp. QH-2
Brite
Enzymes [BR:magq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MGMAQ_2468 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCQ74331
UniProt: W6K8D2
LinkDB All DBs
Position
2515896..2516495
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPFAQDALEPHMCAETLDYHHGKHHNTYVVNLNNLTKDSPMAGQSLEEIISAT
AGDAGKAGIFNNAAQVWNHTFFWNCLSANGGGAPTGDLAAKIDAAFGSLDGFKEQFTQAA
LTQFGSGWAWLVVEGGELKITKTANADTPIAHGQTPLLCIDVWEHAYYIDHRNARPKFVE
TFLGNLANWDFAAANLANA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattgcccgccctgcctttcgcccaggacgccctcgagccgcatatgtgc
gccgagaccttggactatcaccacggcaagcaccacaacacctatgtggtcaacctgaac
aacctgaccaaggacagccccatggcgggtcagtccctggaggaaatcatctcggccacc
gccggtgacgcgggcaaggcgggcatcttcaacaatgccgcccaggtttggaatcacacc
tttttctggaactgcctgtccgccaatgggggcggcgccccgaccggtgacctggccgcc
aagatcgatgccgccttcggctcattggacggtttcaaggaacagttcactcaggctgcc
ttgactcagttcggctccggctgggcctggctggtggttgaaggcggtgaactcaagatc
accaagaccgccaatgccgatacccccatcgcccacggccagaccccgctgctgtgcatc
gacgtgtgggagcatgcctattatatcgatcaccgcaacgcgcggccgaagttcgtcgag
acattcctcggcaacctggccaactgggacttcgcggcggccaatctggccaacgcctga

DBGET integrated database retrieval system