KEGG   Magnetospira sp. QH-2: MGMAQ_3264Help
Entry
MGMAQ_3264        CDS       T03795                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
magq  Magnetospira sp. QH-2
Pathway
magq00630  Glyoxylate and dicarboxylate metabolism
magq01100  Metabolic pathways
magq01120  Microbial metabolism in diverse environments
magq01200  Carbon metabolism
Module
magq_M00165  Reductive pentose phosphate cycle (Calvin cycle)
magq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:magq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MGMAQ_3264 (cbbL)
Enzymes [BR:magq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MGMAQ_3264 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CCQ75096
UniProt: W6KA22
LinkDB All DBs
Position
3323987..3325405
Genome map
AA seq 472 aa AA seqDB search
MAKTYSAGVKEYRETYWMPDYTPAESDILACFKIVPQAGVPREEAAAAVAAESSTGTWTT
VWTDLLTDLDYYKGRAYAIEDVPGDEDAFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGFK
AVRSLRLEDVRFPLAYVMTCNGPPHGIQSERDKMNKYGRPMLGCTIKPKLGLSAKNYGRA
CYEGLRGGLDFTKDDENVNSQPFMRWRERFDYVVEAIHKAEAETGERKGHYLNVTAPTPE
EMYKRAEYAKELGAPIIMHDYLTGGFTANTGLAQWCRDNGMLLHIHRAMHAVLDRNPRHG
IHFRVLTKALRLSGGDHLHSGTVVGKLEGDREATLGWIDLMRDSFIKEDRSRGIMFDQDW
GAMPGVLPVASGGIHVWHMPALVNIFGDDSVLQFGGGTLGHPWGNAAGAAANRVAVEACV
QARNEGRELEKEGKDILTNAAKSSPELKAAMETWKEIKFEFDTVDKLDVSHK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaacttacagcgcgggtgtgaaagagtaccgcgaaacatactggatgccggat
tacaccccggccgaatccgatatcctggcgtgcttcaagatcgttccgcaggcaggggtg
ccgcgtgaagaagctgccgcagccgtggcggccgagtcctccaccggcacctggaccacc
gtgtggaccgaccttttgactgacctggactactacaagggtcgtgcctacgccattgaa
gacgtgccgggcgacgaagacgccttctacgctttcatcgcctacccgatcgacctgttt
gaggaaggctccgtggtgaacgtgttcacctccctggtcggtaacgtcttcggcttcaag
gccgtgcgttcgctgcgccttgaggacgtgcgcttcccgctcgcctacgtgatgacctgt
aatggtccgccccatggcatccagtccgagcgtgacaagatgaacaagtacggtcgtccg
atgctgggctgcaccattaagccgaagctcggcctgtccgccaaaaactacggtcgcgcc
tgctacgaaggcctgcgtggcggtctggacttcaccaaggatgacgaaaacgtcaactcc
cagcccttcatgcgctggcgtgagcgtttcgactatgtggtcgaggccatccacaaggcc
gaggccgagaccggtgagcgcaagggtcactacctgaacgttaccgcgccgaccccggaa
gagatgtacaagcgagccgagtacgccaaggaactgggcgcaccgatcatcatgcacgac
tacctgaccggcggcttcaccgccaacaccggtctggcccagtggtgccgcgacaacggc
atgctgctgcacattcaccgtgccatgcacgccgtgctcgaccgtaacccgcgtcacggc
atccacttccgcgtgctgaccaaggccctgcgcctgtccggtggtgatcacctgcactcc
ggtaccgttgtcggtaagctggaaggcgaccgcgaagccaccctcggctggatcgacctg
atgcgtgactcctttatcaaggaagaccggtcgcgcggtatcatgttcgaccaggactgg
ggcgccatgccgggtgttctgcccgtggcttccggtggtatccacgtctggcacatgccg
gcgctggttaacatcttcggcgacgactccgtgctgcagttcggtggcggcaccctgggt
cacccgtggggcaacgccgctggcgctgctgccaaccgcgtggccgtcgaagcttgtgtc
caggcccgcaacgaaggccgcgagctggaaaaggaaggcaaggacattctgaccaacgcc
gccaagtccagccccgagctgaaggctgccatggaaacctggaaagaaatcaagttcgag
ttcgataccgttgacaagctggacgtgtcgcacaagtaa

DBGET integrated database retrieval system