KEGG   Magnetospira sp. QH-2: MGMAQ_3265Help
Entry
MGMAQ_3265        CDS       T03795                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
magq  Magnetospira sp. QH-2
Pathway
magq00630  Glyoxylate and dicarboxylate metabolism
magq01100  Metabolic pathways
magq01120  Microbial metabolism in diverse environments
magq01200  Carbon metabolism
Module
magq_M00165  Reductive pentose phosphate cycle (Calvin cycle)
magq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:magq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MGMAQ_3265 (cbbS)
Enzymes [BR:magq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MGMAQ_3265 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: CCQ75097
UniProt: W6KN21
LinkDB All DBs
Position
3325461..3325820
Genome map
AA seq 119 aa AA seqDB search
MSDVQDYASSLSDAKSRKFETFSYLPEMNEEQTRKQIAYICSKGWNPAVEHCEPENAFQN
FWYMWKLPMFGETDVDRILAEVEACRKAHPNNHVRLIGYDNYAQSQGASMVIHRGEIKV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtacaagactatgcttccagcctttccgatgcgaagagccggaagttcgaa
accttctcctacctgccggagatgaatgaagagcagacccgcaagcagatcgcctacatc
tgttccaaaggctggaacccggccgtggagcactgcgaaccggagaacgctttccagaac
ttctggtacatgtggaagctgcccatgttcggcgagaccgacgtggaccgcatcctggcc
gaggtggaagcctgccgcaaagcgcacccgaacaaccatgtgcgcctgatcggctacgac
aactatgcccagtcccagggcgcctcgatggtcatccatcgcggtgagatcaaggtctaa

DBGET integrated database retrieval system