KEGG   Magnetospirillum sp. XM-1: XM1_0927Help
Entry
XM1_0927          CDS       T04231                                 

Definition
(GenBank) putative transketolase N-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
magx  Magnetospirillum sp. XM-1
Pathway
magx00030  Pentose phosphate pathway
magx00710  Carbon fixation in photosynthetic organisms
magx01100  Metabolic pathways
magx01110  Biosynthesis of secondary metabolites
magx01120  Microbial metabolism in diverse environments
magx01130  Biosynthesis of antibiotics
magx01200  Carbon metabolism
magx01230  Biosynthesis of amino acids
Module
magx_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
magx_M00165  Reductive pentose phosphate cycle (Calvin cycle)
magx_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:magx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XM1_0927
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    XM1_0927
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    XM1_0927
Enzymes [BR:magx01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     XM1_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CUW37996
UniProt: A0A0U5MFG9
LinkDB All DBs
Position
I:876958..877785
Genome map
AA seq 275 aa AA seqDB search
MTHAVPVPALDERSRHLRRLVIQALDGGGRGHLGSSMSLIEIVRVLYDDVMSHRPAEPRW
EGRDRFILSKGHGCLALYAILADKGYFPEVELVRFCRAGTYLGGHPEAGKVPGVEASTGA
LGHGLSIGVGMALGLRIKKSAARVFVAMGDGEINEGSVWEAAMAAGKHGLANLTALVDFN
KIQSYGFVSEVQPLEPLADKWRAFGFATQEVDGHDLAALRRALGTPDPEGRPRALICHTV
KGRGVPFAENDPAWHHKSKIPAPQIAEMYAALETI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgcggtcccagtgccggcccttgacgagcgttcaaggcatttgcgtcggctg
gtgatccaggcgctggatggcggcggccgcggccatctcggctcgtccatgtctttgatc
gagatcgtgcgggttctctacgatgacgtgatgagccaccgcccggccgaaccgcgttgg
gagggccgggatcgctttatcctgtccaagggtcacggttgcctggcgctttacgccatc
ctggcggacaaaggttatttccctgaggtcgagctggtgcgcttttgccgtgccggcacc
tatctgggtggccacccggaggccggcaaggtccccggtgtcgaggcatcgaccggtgcg
ctgggccatggcctgtccatcggtgtgggcatggcgctcggcttgcggatcaagaaatcg
gccgcccgggtgttcgtcgccatgggcgacggcgagatcaacgagggttcggtgtgggag
gcggccatggctgccggtaagcacggcctcgccaatctcaccgcccttgtggacttcaac
aagatccagtcctacggcttcgtttccgaggtccagccgctggagccgctggccgacaag
tggcgggctttcgggtttgccacccaggaggtcgatggccacgatcttgcggctttgcgc
cgggctctggggaccccggatcccgaggggcggcccagggcgctgatctgtcatacagtc
aagggccgcggagtgccgtttgccgagaatgatccggcatggcatcacaaatccaagatt
ccggcgccgcagatcgccgaaatgtatgccgcgctggagacgatctga

DBGET integrated database retrieval system