KEGG   Magnetospirillum sp. XM-1: XM1_2180Help
Entry
XM1_2180          CDS       T04231                                 

Gene name
aor
Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
magx  Magnetospirillum sp. XM-1
Pathway
magx00030  Pentose phosphate pathway
magx01100  Metabolic pathways
magx01120  Microbial metabolism in diverse environments
magx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:magx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XM1_2180 (aor)
Enzymes [BR:magx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     XM1_2180 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: CUW39249
UniProt: A0A0U5N2N4
LinkDB All DBs
Position
I:complement(2189851..2191701)
Genome map
AA seq 616 aa AA seqDB search
MSWTGKFLRVDLSKGTVKTEELNRDWTRQYLGQRGLATKYFTEEVDPKVDPLSPANKLIF
TTGPLTGTAASTGGRYSVVTKGPLTGCIACSNSGGFFGNELKNAGWDMIIVEGKSPKPVY
LSVENETVEIRDASDFWGKTVWETENGLKARHQDPMLRVASIGAAGEKGVLYACIVNDLH
RAAGRSGVGAVMGSKNLKAVAVRGTRGVTVKDPDRFIKAATEQKKVLADNAVTGQGLPKY
GTQVLMNVINEIGAMPTRNSREVQFEGAHKISAEAMHEPRLSDGKTNLATNGACFGCTIA
CGRISRMDPGHFSIASRPEYKEPSGGLEYEAAWALGSACGVDDIEACTFANFMCNEHGID
PISFGSTLAAAMELYEMGVLTKEQTGGIELKFGSAEALVKTAELTGKGEGFGLELGQGSR
RLTAKYGHPDLSMTVKSQEFPAYDPRGIQGMGLTYATSNRGACHLRSYTVASEVLGIPFK
TDPLATDGKAALVKAFQDATAAFDASGICIFTTFAWSLENLAPQIDAACEGEWTPEVLLE
VGERIWTLERQFNLAAGMTAADDTLPKRLLKDAAKTGPAKGLASGLDKMLPEYYQLRGWT
PDGVPTAETLKRLHLA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagctggaccggcaagtttctccgcgtcgacctttccaagggcaccgtcaagaccgag
gagctgaaccgcgactggacgcggcagtacctgggccagcgcggactggccaccaagtac
ttcaccgaggaggtcgaccccaaggtcgatcccctgtcgcccgccaacaagctgatcttc
accaccggaccgctgaccgggaccgccgcctccaccggcggacgctattccgtggtcacc
aaggggccgctgacggggtgcatcgcctgttccaattccggcggtttcttcggcaacgag
ctgaagaacgccggctgggacatgatcatcgtcgaaggcaagtcgcccaagcccgtctac
ctctcggtcgagaacgagaccgttgaaatccgcgatgcctcggatttctggggcaagacg
gtatgggagaccgagaacggcctgaaggcccggcaccaggaccccatgctgcgcgtcgcc
tccatcggcgccgccggcgagaagggcgtgctctacgcctgcatcgtcaacgacctgcac
cgcgccgccgggcgctcgggcgtgggcgcggtgatgggctccaagaacctgaaggccgtg
gcggtgcgcggcaccaggggcgtcaccgtcaaggaccccgaccgcttcatcaaggccgcc
accgagcagaagaaggtgctggccgacaacgccgtcaccggccagggcctgcccaaatac
ggcacccaggtgctgatgaacgtcatcaacgagatcggcgccatgccgacccgcaattcc
cgcgaggtgcagttcgagggcgcccacaagatctcggccgaggccatgcacgagccgcgg
ctctccgacggcaagaccaatctggccaccaacggcgcctgcttcggctgcaccatcgcc
tgcggccgcatctcgcgcatggatcccggccacttctccatcgcgtccaggcccgaatac
aaggagccctcgggcggcctggaatacgaggcggcctgggcgctgggctcggcctgcggc
gtggatgacatcgaggcctgcaccttcgccaatttcatgtgcaacgagcacggcatcgac
cccatctccttcggctcgaccctggcggcggccatggagctgtatgagatgggcgtattg
accaaggaacagaccggcggcatcgagctgaaattcggctccgccgaggccctggtcaag
accgccgagctgaccggcaagggcgagggcttcggcctggaactgggccagggctcaagg
cgcctcaccgcaaaatacggccatccggacctgtccatgacggtcaagagccaggaattc
cccgcctatgacccgcgcggcatccagggcatggggctgacctacgccacgtccaatcgc
ggcgcctgccacctgcgctcctacaccgtggcgtccgaggtgctgggcattcccttcaag
accgatcccctggccaccgacggcaaggcggccctggtcaaggcgttccaggacgccacg
gcggccttcgacgcgtcgggcatctgcatcttcaccaccttcgcctggagcctggaaaac
ctggcgccccagatcgacgccgcctgcgagggcgaatggacgcccgaggtccttctcgag
gtgggcgagcgcatctggacgctggagcgccagttcaacctggcggccggcatgacggcc
gccgacgacaccctgcccaagcgcctgctgaaggacgcggccaagaccggcccggccaag
gggctggcctcggggctcgacaagatgctgcccgaatactaccagctgcgcggctggacg
cccgacggcgtgcccaccgccgaaaccttgaagcgcctgcatctggcctga

DBGET integrated database retrieval system