KEGG   Methylomicrobium alcaliphilum: MEALZ_2193
Entry
MEALZ_2193        CDS       T01649                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00620  Pyruvate metabolism
mah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MEALZ_2193
Enzymes [BR:mah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     MEALZ_2193
SSDB
Other DBs
NCBI-ProteinID: CCE23879
UniProt: G4STC6
LinkDB
Position
2491389..2494838
AA seq 1149 aa
MTLSTAPIQNSPSSTEEHEGLQHINLKLAALNQPTCEAEGDRQYLKVADSLLKNYSQQRR
LLANYRCPADQRIQDFLNAYLLENNVDVSVQLPGETFILEQKGQARELSLPYRHNEFHSA
YVDSYRVLQGVLHNPQNDRRTTKGVFHIVAGGLPVPGDKSEVPVNAYAALLQHALTPPSD
LLRLPFTSLQNKPATLWVSLLLRPIVRPAIEPISPVKTMETRFFAPGGLVANLDFVESIF
GNAGDPFLPENDAALDIEHWTGHTGCIILAPHLVHCRKKDIGLPHYDDASERQRKDGMCW
HREDELYNDGKPFKLVCRNMQGVVVTLIADNYFGYSKKEIKSQISYSANLFGDCEEEHAG
GALAFPRMNLGDIYLPHGSDLDQRYSFDKLCEQLSPMIQRKDEGYAVDNNFPEIIYIPAA
AEINVQQQRINWLQNGRPQSLKLLAKHTYIYPNGFKVHMERHPHAPSWRLVGTLPEGTFC
HKPSTVSGGGKSEISKSIAGAVISGTIFVEDFEKDMDIVETIFKHDYSTRFRDPARHGSD
KRSLLSNQRTLGSVIKLLTPSVTDYSDDYNEWLELIPQHIWAIVLIIKRFYREEWGDNWR
DYFSVDVVNSYPGNELKYQGRKLIASYLRVGFDSNGAWRVFKLRQDFIASAKVQMEDDIS
ASTVVPSEQLTGLDPDYRNSSVKLVENCEQSFFQRPDDAVHRGSDLQTERDLSGGNNFIS
NFQPLATQDARDLIEDIIHFEEFSEPMRKLIERAAEGQEDDFFVSSAHPRLVDGKPSQNV
RYLQVRPDIADPRMRYIAEISTRLARSLKADQSVYFPVNAVLPGRRNNPQDLAAGIRPLA
VYNPIHYQELPELFMDFVCSLTGKSPSTTGAGSEGALTKGPFNALSTTADLNTALVSFIL
CGYDGFSTAAGYIGTQRRIDHDISLLIPEIWSRLPVAERDARYLIENGHLEKLEDFEYEG
RTVYASRLGYRITERFVHTNFGKVFDYPTAVFDEAMLKPEIQDLAAFVDGIDNVYETQQR
VALIYFQDGTINDACPPLKALLHVMAYGHYEGKTIDDPAIRDLFTRDSLLASDWYRERLS
IKHQRDLALWRRHRDIITECLNETENSDPSEYSKLKVKLEKTEAMLAELSQPGYSESLIG
TLGADWVHH
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgaccttatcaaccgcacccatccaaaatagtccgagtagcaccgaagagcacgaaggg
ctacagcatatcaatctgaaactagccgcactgaatcaacccacttgcgaagccgaaggc
gatcggcaatatctaaaagtcgccgatagcctgttaaaaaattattcgcagcaacgccgc
ctattggccaattaccgttgcccagccgatcaacggatacaagattttttaaacgcttac
ctcctcgaaaataacgtcgacgtttcggttcagttacccggcgaaacattcattctcgag
caaaaaggtcaagcccgggaattatcgctgccttatcgccataacgagtttcactccgct
tatgtcgactcctatcgtgttttacaaggcgtcttgcataatcctcaaaacgatcgacgg
acaactaaaggggtctttcacatcgttgcaggcggacttcccgttccgggcgataaaagc
gaagtaccggttaacgcttatgccgcgttattacaacacgcattgactccaccaagcgat
ctacttcgcttgcctttcacaagcctacaaaataagccggccacgctttgggtctcgtta
ttattgagaccgatcgttcgacccgcaatcgaaccgataagcccggtcaaaaccatggaa
acccgttttttcgcaccgggcggattggtcgctaacttggatttcgtcgaatcgatcttc
ggcaatgccggcgatcctttcttacctgagaacgatgcggcactcgatatcgaacattgg
acagggcataccggttgcattattttagccccgcatttggtgcattgccggaaaaaagat
atcggcctcccccattacgacgatgctagcgaacgccaacgcaaggacggtatgtgctgg
catcgtgaagacgaactttacaacgacggcaaaccgtttaaattggtttgtcgcaatatg
caaggcgtcgtcgtcaccttaatcgccgacaattatttcggttacagcaaaaaagagatc
aaatctcaaatcagctattcggccaatctcttcggcgactgcgaggaagaacatgcaggc
ggcgcgttggcgtttcccagaatgaatcttggcgacatttatctaccgcatggcagcgat
ctcgatcaacgctattcgttcgataagctatgcgaacaattatcgccgatgattcaaagg
aaggatgaaggttacgccgtcgacaacaattttccggagatcatatacattccggcagca
gccgagatcaatgtgcaacagcaacgaatcaattggctgcaaaacggccgcccgcaatcg
cttaaactgctcgccaaacacacttacatctatccaaacggtttcaaggtccacatggaa
cgccatcctcatgcgccgagctggcgactggtcggcaccctacccgaagggacattttgt
cacaaacccagcacggtctccggcggcggtaaatcggaaatttccaaatccatagccggc
gccgtcatttccggaaccattttcgtcgaagacttcgaaaaagacatggatatcgtcgag
actattttcaaacacgattattcgacccgtttccgcgacccggcacggcacggcagcgat
aagcgcagtctgctcagcaatcaacgcaccttgggttccgtcatcaagctattgacacct
tcggtcaccgactattccgatgattataacgaatggttggaactaattccccaacacatt
tgggcaattgtgctgattatcaaacgcttttaccgtgaggaatggggcgataattggcgc
gattatttttcagtggacgtggttaatagctaccccggcaatgaattgaaataccaaggg
cgcaaactgatcgccagttacctacgagttggcttcgattcgaacggtgcttggcgcgtt
ttcaaactacgccaagactttatcgcttcggctaaagttcagatggaagacgacatcagc
gcatcaacggttgtgccttctgaacaactcacggggctcgatcccgattatcgaaattct
tcggtaaaattagtcgaaaattgcgagcaaagttttttccagcgccccgacgatgctgta
catcgaggcagcgatttacaaaccgagcgtgatttatcgggaggcaataactttatctcc
aatttccaacccctagcaacacaagatgcacgcgatctaattgaagatatcattcacttc
gaagaattcagcgaaccgatgcgtaaattgatcgagcgagctgccgaaggacaggaagac
gattttttcgtctcatcggcacatccgagattggtcgacggcaaacctagccaaaatgtg
cgttatctgcaagttcgtcccgatatcgccgacccgagaatgcgttatatcgccgaaatt
tcgactcgtttggctcgaagcctcaaggccgaccaatcggtttactttccggtcaatgcg
gttcttcccggacgccgcaacaatccgcaagatttagccgccggcatccgacctttggct
gtttacaaccccatccattatcaagagttaccggaacttttcatggattttgtatgcagt
ctaaccggcaaatctccttccacgacgggagccggatcggaaggcgcattgaccaaaggg
ccgttcaatgccttgagcacgaccgccgatctaaatactgcactggtctcgttcatctta
tgcggctacgacggcttttcgaccgctgccggttacatcggaactcagcgtagaatcgat
cacgacattagtttattgattccggaaatctggtcgcgcctgcctgtcgccgaacgcgat
gcgcgctatttgatcgaaaacggccacctcgaaaaattggaagatttcgaatacgaaggc
agaaccgtgtatgcaagccggctcggttaccggataaccgagcgtttcgtgcataccaac
ttcggtaaagtcttcgattatccaacagcggtttttgacgaagcgatgctaaaacctgaa
atccaagatcttgccgcttttgtcgacggcatcgataacgtctatgaaacgcaacaacgg
gtggctctgatttatttccaagacggcacgataaatgatgcctgcccgcctcttaaagcc
ctattacatgtcatggcttatggacattatgaaggtaaaaccatcgacgacccggcgatt
cgagatttatttacacgagactcgctactggcaagcgattggtatcgtgagcgactttcc
atcaaacaccaacgcgatttggccttatggcggcgtcatcgcgacataattacagaatgc
ttaaacgaaacagaaaacagcgatccatccgaatattcgaaactgaaagtgaagcttgag
aaaactgaagccatgcttgccgaattaagccaaccgggctattcggaaagtttaatcggc
acgctaggcgcagactgggtgcatcactaa

DBGET integrated database retrieval system