KEGG   Methylomicrobium alcaliphilum: MEALZ_3355Help
Entry
MEALZ_3355        CDS       T01649                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu-B (EF-Tu-B)
  KO
K02358  elongation factor Tu
Organism
mah  Methylomicrobium alcaliphilum
Brite
KEGG Orthology (KO) [BR:mah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mah03012]
    MEALZ_3355 (tufB)
   03029 Mitochondrial biogenesis [BR:mah03029]
    MEALZ_3355 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mah04147]
    MEALZ_3355 (tufB)
Translation factors [BR:mah03012]
 Eukaryotic Type
  Elongation factors
   MEALZ_3355 (tufB)
 Prokaryotic Type
   MEALZ_3355 (tufB)
Mitochondrial biogenesis [BR:mah03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MEALZ_3355 (tufB)
Exosome [BR:mah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MEALZ_3355 (tufB)
  Exosomal proteins of breast cancer cells
   MEALZ_3355 (tufB)
  Exosomal proteins of colorectal cancer cells
   MEALZ_3355 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCE25018
UniProt: G4STM9
LinkDB All DBs
Position
complement(3863875..3865065)
Genome map
AA seq 396 aa AA seqDB search
MSKEKFERKKPHVNVGTIGHVDHGKTTLTAALTKVMADARGGVYKAYDQIDNAPEERERG
ITIATAHVEYESENRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVYLNKADMVDDAELIELVEMEVRELLDMYEFPGDDTPLVIGSALKALE
GDTSDIGVPSILKLVEALDSYIPEPERAIDQPFLMPIEDVFSISGRGTVVTGRVERGIIK
VGQEIEIVGIRPTTTTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKRDEVERGQVLAHKGT
INPHTHFKAEIYVLSKDEGGRHTPFFNGYRPQFYFRTTDVTGAVDLPEGVEMVMPGDNVN
VEVKLIAPIAMEEGLRFAVREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagaaaaattcgaacgtaaaaaaccacacgtaaacgtaggaaccatcggtcac
gtcgatcatggtaaaaccacattgaccgcggcattgacaaaagtgatggcggatgcgcgt
ggaggtgtttacaaggcctacgatcaaattgataacgcccccgaagagcgcgagcgtggt
attacaatcgcaacggctcacgtagagtacgaatcggaaaaccgtcactatgcgcatgtg
gattgcccgggtcatgccgactacgtcaaaaacatgattaccggtgcggcgcaaatggat
ggcgcgatcctggtctgttcggcggccgacggcccgatgccgcaaactcgtgagcatata
ttgttggcacgtcaagtaggtgttccgtatatcgtggtttatttgaataaagccgatatg
gtggatgatgccgaattaatcgaattagtggaaatggaagtcagagaattattggacatg
tacgaatttccgggcgacgatactccgttagttatcggctcggcgttaaaagcgctggag
ggcgataccagtgatatcggcgtgccatcgatccttaagctggtcgaagccttagatagc
tatattccggagcctgagcgagcgattgatcagccgttcctgatgccgattgaggacgtg
ttctcgatttccggacgcggcaccgtggttaccggacgtgtcgagcgtggaatcattaag
gttgggcaagagattgaaattgtcggaattagaccgactacgacgacaacctgcaccggc
gtggaaatgttccgtaagttattggatcaaggccaagcgggcgataacgttggggtcttg
ttaagaggcaccaaaagagacgaagtcgaacgcggacaagtcttggcgcacaaaggtacc
attaatccgcatacgcatttcaaagcggaaatctacgtattatcgaaagacgaaggcggg
cgtcatacaccattctttaatggctatcgtccacaattttatttcagaacaacggatgtg
actggagcggtcgatcttccggaaggcgtggaaatggtgatgccgggcgataacgtcaat
gttgaagtgaaattaattgctccgattgcgatggaagaaggcttgcgattcgcggttcgt
gaaggtggtcgtaccgttggcgcgggcgttgttgcatcaatcatcgagtaa

DBGET integrated database retrieval system