KEGG   Methylomicrobium alcaliphilum: MEALZ_3381Help
Entry
MEALZ_3381        CDS       T01649                                 

Gene name
gatA
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT subunit A)
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00970  Aminoacyl-tRNA biosynthesis
mah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mah00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MEALZ_3381 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mah03029]
    MEALZ_3381 (gatA)
Enzymes [BR:mah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MEALZ_3381 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MEALZ_3381 (gatA)
Mitochondrial biogenesis [BR:mah03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MEALZ_3381 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CCE25044
UniProt: G4SU95
LinkDB All DBs
Position
complement(3893982..3895433)
Genome map
AA seq 483 aa AA seqDB search
MNNKTIAELARGLRSGEFSSVELTQDYLERIRQFSALNAYVTVTTEQALAQAEAADKRLA
AGTADLLTGIPVAQKDIFCTDGVKTSCGSKMLDNFISPYNATVVEKLNAAGAVMLGKSNM
DEFAMGSSNETSFYGSVQNPWNVSCVPGGSSGGSAAAVAAGLTAGATGSDTGGSIRQPAA
FCGITGLKPTYGRVSRYGMIAYASSLDQGGPMTRTAEDAAIMLQAMAGFDEKDSTSVDMP
VPDYSAGLNQPLSGLKIGLPKEFFGEGLGGEIAAVIETAVNEYRKLGAEVKEVSMPNLKH
AIPAYYVIAPAECSANLSRFDGVRFGYRCDNPADLADLYTRSRGEAFGKEVKRRILIGTY
ALSAGYYDAYYLKAQKVRRLITDDFKSALAEVDVLMGPVSPTVAFGLGEKTGDPIQMYLS
DIYTIAVNLAGLPAMSIPAGFVDNKPVGLQIIGNYFAEDRLLNVAHRYQMNTDWHKQVPK
GFE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaaccatcgccgaactagctagaggcttgcgttccggcgaattttccagc
gtggagttgacgcaagactatttagagcggattcggcagttctcggctctcaatgcatac
gttaccgtgacgaccgagcaggcgcttgcccaagcagaagccgcggataaacggttagcg
gcaggaacggccgatttattaaccggaataccggtggcgcaaaaagatatcttctgcacc
gatggcgttaaaacgtcttgcggttcgaagatgctcgataatttcatctcgccgtacaat
gcaactgtcgtcgaaaaactcaatgcagccggcgcagtgatgctcggtaaatcgaatatg
gacgaatttgcaatgggctcgtcgaacgaaaccagtttttatggttcggtacaaaaccct
tggaatgtttcgtgcgttccgggcggttcttcgggcgggtcggccgcggcggttgccgca
ggactcacggcaggcgcgacaggttcggataccggcggttcgatacgtcaaccggcggct
ttctgcggtattaccggattgaagccgacttacgggcgcgtttcccgatatggcatgatt
gcctatgcctcaagcctcgatcaaggcggtccgatgacgcgtactgccgaggatgcggct
atcatgttgcaagcgatggccggtttcgacgagaaggattcgactagcgtcgatatgcca
gtccctgattattcggccggactgaatcagccgttaagcggtttgaaaatcggtctgccg
aaagaatttttcggcgaagggttgggcggcgaaatcgcagcagtcatcgaaacagccgtc
aatgaatatcgcaaattgggtgccgaggttaaagaagtctcgatgccgaatctgaaacat
gcgattccggcttattatgtgatcgcgccagctgaatgttcggcaaatttatctcgtttc
gacggcgttcgtttcggctaccgttgcgacaatccggccgatttggccgatttgtatacg
cgctcgcgcggcgaagcattcggcaaggaagttaagcgccgtatcttgatcggaacctat
gccttgtcggccggttattacgatgcctattatttaaaagctcaaaaagtcaggcgtttg
atcactgatgatttcaaaagcgcattggccgaggttgatgtgctgatgggccctgtatcg
ccgacggtggcgttcggtctcggcgaaaaaaccggtgacccgattcaaatgtatttgtcc
gatatttatacaatcgcggtcaatctggcaggtcttccggccatgtcgattccggccggt
ttcgttgacaataaaccggtcggtttgcaaatcatcgggaattattttgccgaggaccgg
ttgttgaatgtagcccatcgttatcagatgaatactgactggcacaaacaggtgccgaaa
gggttcgaataa

DBGET integrated database retrieval system