KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1461Help
Entry
MICA_1461         CDS       T01630                                 

Definition
(GenBank) shikimate kinase family protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01130  Biosynthesis of antibiotics
mai01230  Biosynthesis of amino acids
Module
mai_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MICA_1461
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     MICA_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 TsaE Cytidylate_kin AAA_22 AAA_16 AAA_5 Mg_chelatase AAA_24 Guanylate_kin
Motif
Other DBs
NCBI-ProteinID: AEP09779
UniProt: G2KND1
LinkDB All DBs
Position
complement(1458325..1458885)
Genome map
AA seq 186 aa AA seqDB search
MGPEALIGLVRGRINRPIVLVGPMGAGKSRLGRRLGQVLGLPFVDSDDEVERAAGMRIPE
IFATLGEPAFRDGEARVIRRLLDNGEQVISTGGGAVMRPETADLIWAQSISIWVRADLAI
LAERTRNGRPRPLLAGKDPEQVLRDLSVIRDPVYARAMIQVDTGSGDDDAIMMQALRGLQ
DLLGDM
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggccccgaggccctgatcggattggtacgggggcggattaaccgccccatcgtactg
gtggggcccatgggggccggcaaatctcgcctgggccgtcgcttggggcaagttttgggc
ctgcccttcgttgattccgatgacgaggttgaacgggctgccggtatgcgcattccggaa
atatttgcaacattgggtgaaccggcgttccgcgacggcgaagcccgggtgatccgccgt
ctgctggataacggggaacaggtgatttccaccgggggcggggcggttatgcgccctgaa
acggcggatctgatctgggcgcaatccatctccatctgggtgcgggcggatctggccatt
ctggccgaacgaacacgcaatggccgtccgcgcccgttgctggctggtaaggacccggaa
caggttttgcgtgacttatccgtgatccgcgaccctgtttatgcccgggcgatgatacag
gtggataccgggtccggtgatgacgatgccattatgatgcaggccctgcgcgggctgcag
gatctgttgggggatatgtaa

DBGET integrated database retrieval system