KEGG   Micavibrio aeruginosavorus ARL-13: MICA_2300Help
Entry
MICA_2300         CDS       T01630                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00473  D-Alanine metabolism
mai01100  Metabolic pathways
mai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MICA_2300 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MICA_2300 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mai01011]
    MICA_2300 (alr)
Enzymes [BR:mai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MICA_2300 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:mai01011]
 Precursor biosynthesis
  Racemase
   MICA_2300 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEP10603
UniProt: G2KT59
LinkDB All DBs
Position
complement(2308493..2309617)
Genome map
AA seq 374 aa AA seqDB search
MMMSDPLTGGRLTIDLNAISANIRHFQDVLGPHCAVAGVVKADAYGLGLVPVAQTLRACG
VKTFFVATPDEGVTLRGLFPGAENIAVLGGLYPGAAQDYRAHRLTPVLNDLGQVSAWRSF
AAGAPCILHIDSGMNRLGLDAADRAAILDDPTRLTGLNLHLVMSHFACADEADHPMTARQ
FTLFDDVARRACPGVPRSIANSSGAMRLQSYHLDMVRPGMAAYGLNPTPETANPMAPVIR
LQVPVLQVRTVPAGDSVGYSATWRAEAPTRVATVALGYADGFLRSFSGRGVLYANGVACP
VLGRVSMDLVTVDAGAVPGLKPGDMLDVVGPGQGVDDLAAQAGTIGYEILTSLGARYRRT
YVHPGIQAGLASEK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtctgatccgttaacaggcggtcgcctgaccattgatttaaatgcaatatcc
gccaatatccgccattttcaggatgtgctcggcccgcattgtgcagtcgccggtgtggtg
aaggccgatgcctatgggctggggctggtgcctgtggcgcaaactttgcgcgcctgtggg
gtcaaaacgttttttgtcgccacgccggatgagggcgtcacgctgcgcggtctgttcccg
ggggcggaaaatattgcggttctgggcgggctttatcccggcgcggcgcaggattaccgg
gcgcatcgcctgaccccggtgctgaacgatctggggcaggtcagcgcgtggcgcagcttt
gccgctggggcgccttgcattttgcatatcgattcgggaatgaaccgcttggggttggat
gccgccgaccgtgcggcgattctggatgacccgacgcgcctgacagggctgaacctgcat
ctggtgatgagccatttcgcctgtgccgatgaggccgatcatcccatgacggcgcggcaa
tttaccctgttcgatgatgtggcccggcgggcttgcccgggtgtgccgcggtccatcgcc
aattcatccggcgcgatgcgtctgcaatcctatcatctggatatggtccggcccggcatg
gcggcctatggcctgaacccgacgccggagacggccaacccgatggccccggtcattcgg
ttgcaggtgccggtgttgcaggtccgcaccgttcccgccggggacagtgtcgggtattct
gccacatggcgtgcggaggccccgacgcgggtggccacggtcgcgcttggctatgccgat
gggttcctgcgctcgttcagcggtcgcggtgtgctttatgcaaatggcgtggcctgtccg
gttctggggcgggtgtcgatggatctggtcacggtggatgcgggtgctgtgccgggcctg
aagcctggcgatatgctggatgtggttggtccggggcaaggcgtggatgacctggcggcc
caggcggggaccattggctatgaaatcctgaccagccttggggcgcggtaccgccgcacc
tatgtccatccggggattcaggcgggcttagcgtccgaaaaataa

DBGET integrated database retrieval system