KEGG   Metarhizium robertsii: MAA_01177Help
Entry
MAA_01177         CDS       T03107                                 

Definition
(RefSeq) Six-hairpin glycosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
maj  Metarhizium robertsii
Pathway
maj00500  Starch and sucrose metabolism
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAA_01177
Enzymes [BR:maj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MAA_01177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19255463
NCBI-ProteinID: XP_007817366
UniProt: E9EN39
LinkDB All DBs
AA seq 586 aa AA seqDB search
MYKKLVSVLAVAGLWLDGAVARSRISCRDDLNAFITKQNHISLDGVLANIGSDGSRAQGA
AAGAVVASPSKSDPDYWYTWSRDSALTFKVLIELFIGGNKSLQPKIEQYMTAQTRLQGVS
NPSGGPDTGGLGEPKFHVNLTAFTGPWGRPQRDGPPLRATALTIYANWLIANGGQAQAAN
TVWPIIAKDLAYTVQYWNRTGFDLWEEINGSSFFTLSASFRALVEGATLAKALGKQCPDC
ETNAPRILCFLQSFWASGYIDSNINVNDGRTGKDVNSIISSIHTFDPAAACTDATFQPCS
SRALANHKAVVDSFRTIYTVNKGRTPGRAAAVGRYSEDVYYNGNPWYLATMAAAEQMYAA
VYQWRKIGSITVDATSLPFFSDLMQNIAAGTYAKDSDTFTSIIRAVTAYGDDFISVVKQY
TPADGSLAEQYDRETGSPKSAVHLTWSYASFVGAVERRSGVVPPSWGEPNANTVPKVCEA
PPSCDSTMTFNVKVTTVPGENIYVVGSITELKNWSPADAIPLDASQYTPSNPLWSAKVTI
PAGTNFEYKYIKKTSEGSVVWESDPNRSATSSTGCRSTGTLNDEWR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagaagctcgtcagcgtgctggcggtggctggcctgtggctggatggagccgta
gctcgcagccgcatttcttgccgagacgacctaaatgccttcatcaccaaacagaaccac
atttcccttgatggagttctggccaatattggctctgatgggtcacgggcccagggtgcc
gcggctggcgctgtcgtggccagcccaagcaagtcggatcctgactactggtatacttgg
agccgggactctgctttgaccttcaaggtcttgatcgagctctttattggcgggaacaag
tctttgcagcccaagattgagcagtacatgaccgcccagacacgtctacaaggggtgagc
aatccttccggtggaccagacacaggcggcttgggagagcccaagttccacgtcaatctc
acagcctttactggtccctggggtaggccacagcgcgatggtcctcctttgcgagccact
gctctcaccatttatgccaactggctcattgccaatgggggccaagctcaggctgcaaac
accgtctggccaattattgccaaagacctggcatacacggttcagtattggaaccgaacc
ggcttcgatttatgggaggaaatcaacggctcctccttctttactctctccgcctcattt
cgcgctctggtcgaaggcgctaccctcgccaaggcactcggcaagcagtgcccagattgc
gaaaccaacgcacctagaatactctgcttccttcaaagcttctgggccagtggctatatc
gactccaacatcaacgtcaacgatggtcgaaccggcaaggacgtcaactccatcatctcg
tccattcacacttttgatcctgcagctgcctgcacagatgccaccttccagccgtgttca
tccagagccctggccaatcacaaggcagttgtcgattccttccgtaccatttataccgtg
aataagggccgaacgcctggcagggcagctgctgtaggccgctactcagaagacgtatac
tataacggtaacccttggtacttggccacaatggcagccgccgagcagatgtacgctgcg
gtctaccagtggcggaaaattggttccattaccgtggacgcgacgtctctccctttcttc
agtgatctgatgcaaaatattgctgcaggcacctatgctaaggactctgacacctttact
tccattatcagggcagtgacggcttatggagatgactttatcagtgttgtgaagcaatac
actcccgccgatggctccctggccgaacagtacgaccgagaaacgggaagccccaagtct
gctgttcacttgacttggtcgtacgcatcattcgtcggagctgtcgaacgcagatctggc
gttgttccaccctcgtggggagagcccaacgccaataccgttcccaaggtttgcgaggct
cctcctagctgtgactccaccatgaccttcaacgtcaaggttaccacggttcccggagag
aacatctatgtcgttggctccattaccgagttgaaaaactggtcaccggcggatgccatt
cccttggatgcgtcacaatacacccccagcaacccgctttggagcgcaaaggtcacgatc
cctgctggtacaaactttgagtacaagtatatcaagaagacgagtgagggaagtgttgta
tgggagagtgaccccaatcgtagcgcgacatcctctaccggatgccgtagcacggggacg
ctcaatgatgagtggagatga

DBGET integrated database retrieval system