KEGG   Metarhizium robertsii: MAA_02642Help
Entry
MAA_02642         CDS       T03107                                 

Definition
(RefSeq) WD40 repeat-like-containing domain protein
  KO
K11274  chromosome transmission fidelity protein 4
Organism
maj  Metarhizium robertsii
Brite
KEGG Orthology (KO) [BR:maj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:maj03036]
    MAA_02642
Chromosome and associated proteins [BR:maj03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    MAA_02642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 Coatomer_WDAD eIF2A Gmad1 MMS1_N IKI3
Motif
Other DBs
NCBI-GeneID: 19256928
NCBI-ProteinID: XP_007818831
UniProt: E9ERP6
LinkDB All DBs
AA seq 849 aa AA seqDB search
MDSTASRPRPRPAHTQGTTRCAYTTDGNRLVTVGSNNTIRLYKTGSDGEPTNIDDCQEQN
VSISAGKDFFVVGSEDGTVSLYNIEAANFERFLLRTTLPIRDVALTRDCQWCAVASDELS
VKIVNIMDITQMKHLREHSKPARHVALEPHGRLAALSCTDGIIYIYSLTSEEPELIRKVD
GIIGTVDSDSEISTKVAWHPDGRAFAVPTPTKDIQVISKNDWEKQRRFADGHLADITALS
WSPNGALLASAGKDGKVLVWETKTQSVIQRFDYSNVVDLAWHPSKNILSFATTDGEVFIY
SDFLHDQFSPLLKLNTQPAPFIHDPLSEISGNRQQPPINGHKIQPIPSRPRRDSLDSIGS
LLDEDGEDDGFVVDDDGAGYAVGRGSKRGRDPDETFGGPSSKRAHFMQPQHHECFQPGST
PWMGNRKYLCLNLIGFVWTVDQDSHHTVTVEFYDHEFQRDFHFTDTFLYDKACLNESGTL
FSSPPKDDAPAYIFYRPHESWTQRSDWRTQLPKGEAVTAMSLSESFITVTTSANYVRVFT
LFGMPYRVYRPKSSPMVTCASWRDYVLTIGNGPVGSDGTARLLYTIENIKRDEICQNEDT
VALPEGATLKSVFFSDNGDPCIYDSTGTLLTLLHWRQPSRACWVPLLDTKLLSRLASGRK
SETYFPVAVADHKFHCIILKGGDKYPYFPRPLLSEFDFSIPLASPSEKKKKSDDTEKEQD
EVMDEDKEEEGEDFETRKLEQQFMLKGVQAAQLRDLVEATSGNHTQRSLLSRIELEIDKT
LLQLLAVECRQGEDRGMRALEMVELMRDRTGRMMEAAGKVAERYGRTVLGEKIREVGEKR
IGVMDEEGF
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggattcgacagcatcgcggccgcggccacggcctgcccatacccagggaaccacccgg
tgtgcgtatacgaccgatggcaatcgactggtgactgtcggctcgaacaacaccatccga
ctctacaaaaccggctctgacggcgagcctacaaacatagatgactgccaggagcaaaac
gtgtccatctcagcggggaaggacttctttgtcgttggttccgaagatggcaccgtcagt
ctttacaacatcgaggctgccaactttgaacgctttcttctgcgtaccactcttcccatc
agagacgttgcattaactcgcgactgtcaatggtgtgctgttgctagcgatgagcttagt
gttaagattgtcaacataatggatatcacacagatgaagcatttgcgagagcacagcaag
cctgccagacatgtcgccctggagccccatggaaggctagccgcgttgtcttgtaccgac
ggtatcatatacatttattccctgacatccgaggagcctgaacttatccgcaaagtggat
ggaataattggaaccgtggactctgattctgagatatcaaccaaagttgcttggcatcct
gatgggcgtgcatttgccgtgccaaccccgaccaaagatatccaagttatctccaagaac
gactgggagaagcagagacgcttcgctgatggtcacttggccgacataactgccctttcc
tggtctccaaatggtgccttgttagcttcggcgggcaaggacggcaaggtcttggtctgg
gaaaccaagacacaaagtgtaattcaacgatttgactactccaatgtagtcgatctcgca
tggcatccgtccaagaatattctgtcatttgcaactacagacggcgaagttttcatctac
tcggacttcctccatgaccagttttctccattattgaaactcaacacacaacctgctcca
ttcattcatgatcctttatccgagatatcgggaaatcggcagcaacctcctatcaatggt
cataaaatccagccaattcccagtcggcctcgtagggattcgttagacagcattggctca
ttgcttgatgaagatggggaagatgacggttttgtggtcgacgatgacggggctggttat
gcggttggcagaggaagtaaacgaggacgagatccggacgagacatttggcggtccttca
agcaagagggctcatttcatgcaaccacaacaccatgagtgctttcaacccggctcgact
ccttggatgggcaacaggaaatacctatgcctgaatctcataggatttgtatggaccgtg
gatcaagattcgcaccatacagttacagtggagttttatgatcacgaattccagcgagac
ttccattttacagacacatttctctacgacaaggcttgtctgaatgaaagtggcaccttg
ttctcaagtccacccaaagatgatgcccccgcctacattttctacaggccacacgagagt
tggactcaacgatcagattggcgaacacagttacccaagggtgaagccgttacagcaatg
tctttgagcgagtcgttcattacggtaaccacgtccgccaactatgttcgagttttcact
ctatttggaatgccctaccgagtgtatcgtcccaaaagctcacctatggtgacttgtgcc
agttggagagactatgtgctcacaattggcaatggccctgttggatctgatggaaccgcc
cgtctactctacacgattgaaaatatcaaacgcgatgagatttgccaaaatgaggacaca
gtcgctttaccagaaggggcaacactcaaaagtgttttcttctcagataacggcgaccca
tgcatttacgactccacgggcaccttacttacactgcttcactggcgtcaaccatctcgt
gcgtgctgggtgcccttactggacaccaaactcctgtcgcgtctggcgtcgggccgaaaa
agcgagacgtactttccagttgccgttgcagaccacaagttccactgcatcatcctcaag
gggggcgacaaatacccctacttccctcgaccactgctatcagaatttgacttctccata
cctttggcatcaccgtccgagaagaagaagaagagcgatgacaccgagaaggagcaagac
gaagtcatggacgaagacaaagaagaagaaggcgaagactttgagacgagaaagctcgag
cagcaatttatgctgaagggcgttcaagccgctcaactaagagacctcgtcgaggccacc
tccggaaaccacacccaaagatccctcctctctcgcatcgagctggaaatcgacaagact
cttctgcaattactagcggtggaatgtcgccagggcgaagaccgcggcatgcgtgccctc
gaaatggtggaacttatgcgtgacagaacaggccgtatgatggaggcggcaggcaaggtg
gccgagcgttacggccgcaccgttttgggcgaaaagatccgcgaggttggcgagaagaga
attggcgttatggacgaggagggcttctaa

DBGET integrated database retrieval system