KEGG   Metarhizium robertsii: MAA_02791Help
Entry
MAA_02791         CDS       T03107                                 

Definition
(RefSeq) Glutathione S-transferase/chloride channel
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
maj  Metarhizium robertsii
Pathway
maj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MAA_02791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maj02000]
    MAA_02791
Enzymes [BR:maj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MAA_02791
Transporters [BR:maj02000]
 Other Transporters
  Pores ion channels [TC:1]
   MAA_02791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_N GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 19257077
NCBI-ProteinID: XP_007818980
UniProt: E9ES45
LinkDB All DBs
AA seq 277 aa AA seqDB search
MANVDTSLPPEPSGAAAELASRHASEHALKLYGGWFCPFVQRAWITLCEKQIPHQYIEIN
PYKKEADFLAMNPRGLVPTLAVPTGPEGESHKPLYESLVICEFLEDAYSDEAKHGRRLLP
SDPYERARARLWIDHVGTRIVPAFYRFLQHTPEKPYSIEQARAEFHSHIRTLTEEMDPDG
PWFLGEHLSLVDISLAPWAKRLWLLDHYKSGGLAIPQADGDAIWQRWFKWYHAIVDRQSV
KDTWSADERYIIAYKRYADDTTNSLVGQATRQGQRLP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtcgatacctcacttccgccggagccatcgggcgcggctgccgagttggcc
tcccgccatgcctctgaacatgcactcaagctgtacggcggatggttctgccctttcgtt
cagcgggcttggatcacattgtgtgagaagcaaattccacatcagtacattgaaatcaac
ccctataagaaagaagccgactttctggccatgaaccctcgcggcctggtgccaacactg
gctgttcccaccgggccagagggagagagccacaaaccactatatgaaagtctggtcatc
tgtgaattcctggaggacgcgtactcggatgaagccaagcacggccgtcgtttgcttccg
tcagatccctacgagcgtgcccgcgcccggctgtggatcgaccatgttggcacaagaatc
gtcccagccttctaccgctttctacagcataccccggagaagccatatagcatcgagcag
gctcgggcagagtttcacagccatatacgcaccctgacagaggaaatggatcctgatggg
ccatggtttttgggcgagcacctaagtttagtcgacattagcctggccccttgggcaaaa
cgactgtggttgcttgatcactacaagtccggcggactagctattccacaagctgatgga
gatgccatctggcaacgctggttcaagtggtaccatgccattgttgaccgacagagcgtc
aaggacacttggagcgctgatgaacgatatattatagcttacaaacgctacgcggatgat
accacaaattcgctcgtcgggcaggccacaagacaaggacagaggttgccataa

DBGET integrated database retrieval system