KEGG   Metarhizium robertsii: MAA_03118Help
Entry
MAA_03118         CDS       T03107                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
maj  Metarhizium robertsii
Pathway
maj00020  Citrate cycle (TCA cycle)
maj00480  Glutathione metabolism
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
maj01130  Biosynthesis of antibiotics
maj01200  Carbon metabolism
maj01210  2-Oxocarboxylic acid metabolism
maj01230  Biosynthesis of amino acids
maj04146  Peroxisome
Module
maj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAA_03118
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MAA_03118
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MAA_03118
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MAA_03118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19257404
NCBI-ProteinID: XP_007819307
UniProt: E9ER76
LinkDB All DBs
AA seq 458 aa AA seqDB search
MNSAARLLSSHLPLRRAPIASVRASSSRFAPSFGAVRTFSVSARNMAAARKIKVKNPVVE
LDGDEMTRIIWQTIKDKFIYPYLDIDLKYYDLGLEYRDKTNDQVTVDAAEAIKKYSVGVK
CATITPDEARVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWEKPIIIGR
HAFGDQYRAKDLVAPGPGKLSMVYTPEGGEPQEVEVYQFKNGGGVAQAQYNTDESITGFA
HASFKLALDKGLPLYMSTKNTILKKYDGRFKDIFQELYDTQYKKDFEAKKIWYEHRLIDD
MVAQMIKSKGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVT
RHYREHQKGKETSTNPIASIFAWTRGLIQRGKLDNTPELVAFAESLEQACIDTVDKDGVM
TKDLALACGKNERSDYVTTNEYLNAVERRMKTILKEKL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgccgctagactcctctcctcacaccttccccttcgccgtgcgcccattgcc
tcagttcgcgcttcctcctctcgatttgcaccttctttcggcgccgtccgcaccttttca
gtctcagcacgcaacatggctgccgcacgcaagatcaaggttaagaatccggtcgtggaa
ctcgacggcgatgagatgacacgcattatctggcagactatcaaggacaagttcatctat
ccttaccttgatatcgatctgaagtactacgatctgggtctcgaataccgcgataagacc
aacgaccaggtcactgttgatgccgccgaggctattaagaagtactccgtcggtgtcaag
tgcgctaccattacacctgatgaggctcgtgttgaagaattcaagctgaagcaaatgtgg
ctgtcaccaaacggcacaattcgaaatgctctgggcggcactgtcttccgtgagcccatc
gtcatccctcgtatcccgcgtctggtccccggttgggagaagcccattattattggtcgc
catgcctttggtgaccaataccgcgccaaggacctcgttgcccccggaccaggcaagctg
tccatggtttacacccctgaaggtggcgagcctcaagaggtcgaggtctaccagttcaag
aacggtggtggcgttgcccaagcgcagtacaacactgacgagtccattactggctttgct
catgcctccttcaagcttgctcttgacaagggcctgcccctctacatgagtaccaagaat
accatccttaagaagtacgatggtcgcttcaaggacatcttccaggagctctacgatacc
caatacaagaaggactttgaggccaagaagatctggtacgagcaccgtctcattgatgat
atggttgcccagatgattaagagcaagggcggttacatcatggctctcaagaattacgac
ggtgatgtccagtctgacattgtcgctcagggcttcggttcccttggcctcatgacctcg
gtcctcatcacccccgacggcaagacgttcgagtccgaggccgcccacggcaccgttacc
cgccactaccgtgagcaccagaagggcaaggagacctctaccaaccccattgcctccatc
ttcgcctggacccgcggtctcattcagcgtggcaagctcgacaacacgcccgagctcgtg
gcctttgccgagagcctcgagcaggcttgcatcgacaccgtcgataaggatggcgtcatg
accaaggatttggccctggcctgcggcaagaacgagcgctccgactacgtcacgaccaac
gagtacctgaatgccgttgagcgccgcatgaagaccatcctcaaggagaagttgtaa

DBGET integrated database retrieval system