KEGG   Metarhizium robertsii: MAA_03512Help
Entry
MAA_03512         CDS       T03107                                 

Definition
(RefSeq) histone H3 lysine 36 (K36) methyltransferase
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
maj  Metarhizium robertsii
Pathway
maj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MAA_03512
Enzymes [BR:maj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MAA_03512
Chromosome and associated proteins [BR:maj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     MAA_03512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26
Motif
Other DBs
NCBI-GeneID: 19257798
NCBI-ProteinID: XP_007819701
UniProt: E9EU13
LinkDB All DBs
AA seq 894 aa AA seqDB search
MEDDEHAARSMSRIKLEDGIANGQPEAMDTAESTPTHGIKGGASPASINGIKSESDGVNT
PASGKPRLSRRSSQKPAESELRLFNHLPNVTEESCKSFQVIRDCLYGSKHLGSTDNDALD
CDCAEEFQDGENFACGEDSDCINRATKMECVASGSNCGGGCQNQRFQRKLWADVAVIKTD
KKGYGLRTESPLQPNDFIYEYVGEVINEPTFRRRMLQYDEEGIKHFYFMSLSKSEFVDAT
RKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFALRKIQAGEELVFNYNVDRYGAEPQPC
YCGESNCVGFIGGKTQTERATKLPTTVVDALGIHDADGWDTAVAKKPRRKRPEEDDEEYV
NSLPARSLDEDGSRKVMAALVQCKEKWIAVKLLERIQRSDDDRVIHSVMRMHAYQILKTT
LNTFIDDHNVVLQVLDILDKFPRMTRNKIQDSNIEATIQHLTNSEHEDVSAKSKKLLDGW
SKLEVAYRIRRRKVDPNAPVQNLFDDRRGQAREEETAQSTPKTASPRPIDAPKGPKSSIP
QRSVSFQHNNVNRPPRRFGPLPEGWFTAKDGKGHTYYYNKLGKTTWSRPTQPANDGPKAP
SKAIQEQLAIQSIIDRVTKEGTPKQALPQPTPSHVSDSSSKESRRSKWKALPIEKQMKIY
ENTVFPPVKHMLDKFRHRLPKEELKRLGKDIAKKLVASDYKNNRVEDPTAALSEKQTLKI
KKHVKDFLTRAVEKYEVHQQKQAPKDTKPGNADGKTATASDASQSVGAEMADDIALSDME
ENDSPSSQERKRKREADAADSAGATPSEGPETKRPRAEDGTEPSPPPPPPPPPDSSSDDT
LTEEQNAEQRAFKEQEEALMRENEEAQRLEDEANKTKDMEEKAEEIRKDIVLAA
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgatgagcatgcagccagaagcatgagtaggatcaagctggaagacggaatc
gcgaatgggcaacctgaagccatggacacggccgagtctacgccaacgcacggcatcaag
ggtggtgcatcgcctgcatccatcaatggcatcaaatcagagagcgacggggtgaatact
cccgcctcgggaaagccacgcctatcgcgaagatcttcacaaaaacccgccgagtccgaa
ctacgactattcaaccacctcccaaacgttaccgaggagtcttgcaagtcctttcaggtc
attcgagactgtctctacggatcaaaacacctcggttctaccgacaatgacgctttggac
tgtgattgtgccgaggaatttcaagatggggagaattttgcttgtggcgaggattccgac
tgcatcaaccgcgctacaaaaatggagtgtgtcgccagcggcagcaattgcggtggtggt
tgccagaatcaacgctttcaacgcaagctctgggctgatgttgctgtcatcaagactgac
aagaaagggtatggtcttcgaaccgaatctcctctacaaccgaacgactttatttacgag
tatgttggtgaggttatcaacgaacccacgtttcgacgacgtatgctgcagtacgatgag
gagggcatcaagcatttctatttcatgtccctgagcaagagtgaatttgttgacgcaacc
agaaagggtaacctcggtcgcttctgtaaccactcatgcaatcccaattgctacgtggac
aagtgggttgttggggacaagctgcgcatgggcatctttgcattgcgcaagatccaagcc
ggtgaggaactggtattcaactacaatgttgaccggtacggtgccgaaccgcagccatgc
tactgcggcgagtcaaactgcgttggattcatcggaggaaagactcagactgagcgcgcc
accaagttaccgaccacagttgttgatgcacttggcattcatgacgccgatggttgggat
accgccgttgccaagaaaccacgccgcaagcgacccgaggaagatgatgaagagtatgtc
aacagcctgccagcccggagcttggatgaagacggttcgagaaaggtcatggccgcgctt
gtgcaatgcaaggagaaatggattgccgtcaaacttcttgagcgtatccagcgctccgat
gatgaccgagtcatccactccgtcatgcgtatgcacgcctaccaaattctcaaaaccacc
ctcaacacgttcatcgacgaccacaatgttgtgttgcaggtactggatatccttgacaaa
ttcccacgcatgacgagaaacaagattcaagactccaacatcgaagcaacaatacaacac
ttgacaaattcggaacacgaggatgtatcagccaaatcaaagaaactgctggacggctgg
agtaaactggaagtggcatatcgcattcgaaggaggaaggttgaccccaatgcaccagtt
cagaatctttttgacgaccgcagaggacaagctcgcgaggaagaaacggctcagtcaaca
ccaaaaacagcatcgccgcggcccattgacgctccaaagggccccaagagcagtattccc
cagcgtagtgtatcgtttcagcataacaacgtcaatcgaccacctcgacgcttcggacca
ctcccggagggctggtttacagccaaggacggcaaaggtcacacctattactacaataaa
ctaggcaaaaccacttggagcagaccaactcagcccgcaaacgacggaccaaaggcgccg
tccaaggccatacaggaacagctggctatccaaagtattattgatcgcgtgaccaaggaa
gggacaccgaagcaggctctgccccagccaactccatcacatgtcagcgactcatcatcc
aaggaatccaggaggagcaagtggaaggcactgcctattgagaagcagatgaagatttat
gaaaatacggtcttcccgccagtcaagcacatgctagacaaatttcgtcacaggcttccg
aaagaagaactcaagcgactaggtaaagatattgccaagaagctggtagcatctgattac
aagaacaacagggtggaggatccaacagcagccctcagcgagaaacagactctaaaaata
aagaagcatgttaaggactttttaacacgggcagtcgagaagtatgaggtgcaccagcag
aaacaggccccgaaggataccaagccagggaacgccgatggcaaaactgccaccgccagc
gacgcatcgcagagcgttggagccgagatggcagacgacattgcgctcagtgacatggaa
gaaaacgactcccctagtagccaagagcgcaaacgcaaaagagaggcagatgcggcagac
tcggccggcgcaacaccctccgagggaccagagacgaaaagaccacgagccgaagacggg
accgagccatctcctccgcctcctccgcctcctccaccggactctagctcagacgacacc
ctaacggaagagcaaaacgcggagcaaagggccttcaaggaacaggaagaggcgctcatg
cgagaaaatgaggaagcgcaacggctagaagatgaggccaacaagaccaaggacatggaa
gaaaaggctgaagagatacggaaggatatagttcttgcggcatga

DBGET integrated database retrieval system