KEGG   Metarhizium robertsii: MAA_04608Help
Entry
MAA_04608         CDS       T03107                                 

Definition
(RefSeq) proteinrelated to alpha-glucosidase b
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
maj  Metarhizium robertsii
Pathway
maj00052  Galactose metabolism
maj00500  Starch and sucrose metabolism
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MAA_04608
   00500 Starch and sucrose metabolism
    MAA_04608
Enzymes [BR:maj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MAA_04608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19258894
NCBI-ProteinID: XP_007820895
UniProt: E9EX59
LinkDB All DBs
AA seq 926 aa AA seqDB search
MRAGAVIQFFFALGGIAATPKPNTRDRLRECPGYRAVKDGQISDGLWRFLEIHDDRARFI
DLELAGKPCNVYGKDLPFLKVTHVVETPTRLHVQIADPKQEAYQVPELVFPRPKFSRKRQ
SKKPLLEFEYTEYPFSFRIVRTKDTTILFDSSAAGLVFEDQYIRLRTSLPVNPNLYGFGE
HSDSFRLKTNNYTRTLWNADTPSVPAGWNLYGSHPMYIEHRQKGTHGVFLLNSNGMDVVI
DSDPYSAYLEYNILGGVLDFYFFAGETPIDVAKQYSEVVQQPALVPYGALGLHQCRWGYQ
DVFNVAEVVHNYSQAGIPLETMWTDIDYMDGRAAFSLDPERFPLEKMRQLVQHLRSRNQK
FVMMLDPAIAVKDYGPYNNGKTWPMSFLVNSSGLPYEGVVWPGRTVYPDWFAPAIQEYWN
KEFDTFFNPATGVDIDYLWIDMNEPSNFCDFPCNNIDEVALQYPPPPPLVRSPPRELPGW
PCDFQPPGTKCDDNGIKPLPSRKKPRTVYLYFPEPMLSIPPLYFPLMEEVKPGYRPFFLG
FDNRDLINPPYTINNAWGVLPQKSLNTSIRHSNGLTLFDTHNLYGHMMAAASRRALIAMR
SHKRPFIVTRSTFAGSGAHAAHWLGDNDSSWEHYRLSIRQMLQFNSMFQVSMVGSDVCGF
NGDTTEELCARWAMLGAFQPFYRNHNAEGQIDQEFYRWPSVTQAAKKAIDIRYRLLDYFY
TALMIQSSDGTPAINPMFYIYPKDANTWGLDMQYFFGPSLMVAPVQEQGSTSVKIYFPND
VFYDFHTHEQFFGIGQYATRTNQTITDIPLFVRGGQIMPMRARSTMTTTELRQQDFELLI
AVGSNGRAKGVLYLDDGETLQKPPHSYIEFNYKGGRVTSKIRSMDFKTGAKITKITIMGG
KRCGPGKSSCSKDLHHPLKKRLSVKI
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgagagctggcgcagttattcagttcttctttgcccttggcgggatagctgctactcca
aaaccgaatacccgcgatcgtctgagagaatgccccggctacagagcggtcaaggacggc
caaatttcggacggtttgtggcggtttctggaaatccatgatgacagggccagattcatc
gacttggaactcgctggcaaaccttgcaacgtctacggcaaggatctcccgttcctaaag
gtcacgcatgtggttgagactcccacgcgccttcacgtccaaattgccgatccaaaacag
gaagcctaccaagttcccgaacttgtctttccccgtcccaagtttagcagaaagagacag
agcaaaaagccacttttggagttcgaatacaccgaatacccgttctcattcagaattgtt
cgcaccaaggacactacgatactcttcgactcgtctgccgcaggactggtctttgaggac
cagtatattcgtttgcgtacctcgctacccgtgaatcctaacctgtacggctttggggag
cactctgattccttccggctaaagaccaacaactatacgcgtacgctgtggaatgccgat
accccttctgtccctgctggttggaatctctacggaagtcaccccatgtacatagagcat
cgtcaaaagggaacccacggcgtcttcttgctcaactcgaacggcatggatgtcgtaatc
gacagcgatccctatagcgcctacttggagtacaatatccttggcggagtgctcgacttt
tacttctttgctggagaaactcccattgacgtggccaagcagtattccgaggtcgtccag
cagccagccttggtgccttacggtgcgctgggacttcaccagtgtcgatggggctaccaa
gatgttttcaacgttgctgaagtcgtgcacaactacagccaagctggtattcctctcgaa
accatgtggacggatattgactacatggatggccgagctgccttctccctagaccctgag
cggtttcccctggaaaagatgcgtcagttagtacagcatctccgctccaggaatcaaaaa
ttcgtcatgatgctggatcctgccattgccgtcaaggactacggcccttacaacaacggc
aagacgtggccaatgtccttccttgtcaactcatcggggttaccctatgaaggtgtcgta
tggcccggccgcaccgtctacccagactggttcgcccctgccatccaggaatactggaat
aaggagttcgacaccttctttaaccctgcaacaggcgttgacatcgactacctgtggata
gacatgaacgagccttccaacttttgcgacttcccgtgcaacaatattgacgaggtagct
ctgcagtacccgcctccaccaccgctcgttcggtcaccgccgagagaattacctggatgg
ccttgtgacttccagccaccgggcacaaaatgcgacgacaatggaataaagcccctcccc
tcccgaaagaaaccccgtactgtctacctctatttcccagaacctatgctatctatacct
cccctctacttccccttgatggaggaagtcaaaccaggttacagacccttctttctaggc
ttcgacaatcgtgatctcatcaaccccccctacaccatcaacaacgcctggggtgtgctg
ccgcaaaagagtctcaacacgagcatccgtcacagcaatggcctcactctctttgacacg
cacaatctctacggacatatgatggctgctgcctcacgcagagccctcatcgctatgcgt
tctcacaagcgtcccttcatcgtcacacgctctacctttgctggctcgggagcccacgcc
gcgcactggctgggtgacaacgactctagctgggagcattaccgcttgagcattcggcaa
atgctgcaattcaattccatgttccaggtgtccatggttggatccgacgtctgcggcttt
aacggggataccactgaggagctctgtgcgcgatgggccatgctcggcgccttccagccg
ttttaccgtaaccacaatgccgagggacaaattgaccaggagttctaccggtggccttcg
gtcactcaggctgcgaagaaggcgattgacattcgttacaggctgctcgactacttctac
acggccttgatgatacaaagttctgatgggacgccggctatcaatcccatgttttacatt
taccccaaagatgcaaatacttggggcttggacatgcagtacttcttcggcccttcgttg
atggttgcgccagtccaggagcaaggatctacaagtgtaaaaatctacttccccaacgac
gtcttctacgacttccacacgcacgagcaatttttcggcatagggcagtacgccactaga
acaaatcagaccatcaccgatatcccgctctttgtccgaggtggtcaaatcatgcctatg
cgtgccaggtctaccatgaccacaaccgagcttcgccagcaagatttcgaactgttgatt
gctgtcggcagcaacggcagggccaaaggagtgttgtatttggacgacggggagactttg
caaaaaccgccgcattcgtacatcgagttcaattataagggcggcagggttacttccaag
atacgatcaatggatttcaagactggagcgaaaataacaaagattaccattatgggcggc
aaaagatgtggacctgggaagtcgtcctgctcgaaagatctacatcacccactaaaaaaa
cgactgagtgtaaagatttag

DBGET integrated database retrieval system