KEGG   Metarhizium robertsii: MAA_04623Help
Entry
MAA_04623         CDS       T03107                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
maj  Metarhizium robertsii
Pathway
maj00250  Alanine, aspartate and glutamate metabolism
maj00410  beta-Alanine metabolism
maj00430  Taurine and hypotaurine metabolism
maj00650  Butanoate metabolism
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
Module
maj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MAA_04623
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAA_04623
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAA_04623
   00430 Taurine and hypotaurine metabolism
    MAA_04623
Enzymes [BR:maj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MAA_04623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 19258909
NCBI-ProteinID: XP_007820910
UniProt: E9EX74
LinkDB All DBs
AA seq 516 aa AA seqDB search
MTVTATTTNGHVNGNAANGSTARLNRAEELDDLLSAVRDLILPFIKAADDAAAHRETGRL
PLDATGTPHNVLVDAVQPHSLAAHLKFILPEEGQGKQGLLEGIVRVLKYSVNTWDQGFLD
KLYASNNPVGVISDIVLSVLNTNLHVYQVSPALTIIEKTTGRALANKFGFTGPRAGGVTC
QGGSSSNLTSLVVARNTLYPDCKTEGNAKHDFIVFTSAHGHYSVEKSAMICGMGSSNVWK
VPVDDGGSMKADALRELVVRANEQGKTPLYVNTTAGSTVRGSYDPFEDISKICKEFGLWM
HIDASWGGPVVFSAQQRWKVKGSHLADSITINPHKMLNAPTTCSFLLGPDMSLFNKANTT
DAGYLFHGSTEDDVWDLADLTLQCGRRGDSLKVALAWLYYGANGFERQVDHAFDMASYLW
KLVQQTGNFAMVSENPPPCLQVCFYYAPNGDLSSDAATNTNRTQALVEKLIGRGFMVDYA
PGDVGSFLRIVVNVQTLPSTVEGLTRALEEAGKEVA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgactgccacgacgaccaatggtcatgtgaatggtaacgcggccaatggatca
accgctcgcttaaatagagccgaagagttggatgatctgctatcggccgtgcgcgacttg
attctgccctttattaaagccgccgacgatgccgcggctcatcgggaaactggccggctc
ccgctcgacgccactggcacacctcacaatgtcctcgtcgacgccgtccagcctcacagc
cttgctgcacatctcaagttcatattgcccgaggaagggcagggtaagcaggggctgttg
gagggcatcgtaagggtgctcaagtacagcgtcaatacttgggaccaggggtttctcgat
aagctatatgcaagcaacaatcccgttggcgttatttcagacattgtcctgtcggtcctc
aacacaaatctgcatgtgtaccaagtctcgccggcacttaccattatcgaaaagacgacg
ggacgcgcattggccaacaagtttggcttcacgggcccgagagccggtggcgtaacttgc
caaggtggcagctcttcaaatctcacctccctggtcgttgcgcggaacaccttgtacccg
gactgcaagaccgagggcaacgccaagcatgactttattgtgttcacgagcgctcatggc
cattactctgtggaaaagagcgccatgatctgtggcatgggctcatctaatgtgtggaaa
gtacctgttgatgatggcggaagcatgaaggcagatgcccttcgcgagctggtggttcgt
gccaatgagcagggaaagaccccgttgtacgtcaacaccactgcgggctctacagttcga
ggttcctacgacccgttcgaggacatctcaaaaatatgcaaagaattcggtctctggatg
cacattgacgctagctggggcgggccagtcgtcttttctgcccagcagaggtggaaggtc
aaaggatcccatctcgctgattccatcaccatcaacccccacaagatgttgaatgcgccc
accacgtgttcctttttgctgggcccagacatgagcctattcaataaggcaaacaccacc
gacgccggatatctcttccacggaagcaccgaagacgatgtctgggaccttgcggatttg
acattacagtgcggccgccgaggcgacagcttaaaggttgctctcgcatggctgtattat
ggagccaacggcttcgagaggcaggttgatcacgcattcgatatggcgtcctacctgtgg
aaactggtgcagcagacgggcaacttcgccatggtgtcggaaaacccgcccccgtgcctc
caagtgtgcttctattacgcacccaacggcgatttgtcgagcgatgcagcgacgaacacg
aatcgcactcaggccttggttgagaaattgattggcaggggcttcatggtggactatgct
cctggagacgtgggaagtttcctgagaattgttgtcaatgtccagactttgccaagcact
gtcgagggattgacgagggctctggaggaggctggaaaggaagtggcttag

DBGET integrated database retrieval system