KEGG   Metarhizium robertsii: MAA_04836Help
Entry
MAA_04836         CDS       T03107                                 

Definition
(RefSeq) hypothetical protein
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
maj  Metarhizium robertsii
Pathway
maj00062  Fatty acid elongation
maj01040  Biosynthesis of unsaturated fatty acids
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
maj01212  Fatty acid metabolism
Module
maj_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    MAA_04836
   01040 Biosynthesis of unsaturated fatty acids
    MAA_04836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maj01004]
    MAA_04836
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     MAA_04836
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     MAA_04836
Lipid biosynthesis proteins [BR:maj01004]
 Fatty acid synthase
  Component type
   MAA_04836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Polysacc_synt_2 NAD_binding_10 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 19259122
NCBI-ProteinID: XP_007821123
UniProt: E9EXT7
LinkDB All DBs
AA seq 346 aa AA seqDB search
MDKILVNPYVAGIKSHVEQLGPIPQPVLGAFAGVGALWLTYKLFSYLQLVLSAFVFSGHN
LRKYGRAGSWAVVTGASDGLGKEYASQLAAKGFNLVLVSRTKSKLESLAKELQEKYHGKD
LDIKIHAMDFAKDDDADYEKLAEVVRGLDVAILINNVGQSHSMPVSFLETPKDELQNIVI
INCLGTLKVTQIVAPILKQRKHGLILTMGSFGGWTPTPYLATYSGSKAFLQQWSNALSSE
LADDHVDVYLVLSHLVTTAMSKVRRPSLLIPNARNFVKAALGKVGLGGYQTAPNTYTPWW
SHSFMLWLIENVPGVNSPVTIWYNKKMHLDIRRRALRKQAREAKKQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggataagattttggtgaatccttacgtggcaggcatcaagtcgcacgtcgagcagctg
ggcccgattccccagcctgtgctaggtgcctttgctggcgttggcgcactttggctcaca
tacaagctctttagctatctccagctcgtcctgagtgcattcgtcttctccggtcacaat
cttcgcaagtatggccgcgctggatcatgggccgtcgtcactggtgcctcggatggtctt
ggtaaggagtatgcttcccaactcgctgccaagggcttcaatctcgtcctcgtttcccga
accaaatccaagctcgagtcactcgccaaggaactacaagagaaataccatggcaaggac
cttgatatcaagattcacgccatggacttcgcaaaggacgacgatgctgattatgagaag
cttgccgaggtcgttcgtggcctcgacgttgctatcctgataaacaatgtcgggcagagc
cacagcatgcccgtctctttcctcgagacacccaaggacgagctgcagaacattgttata
atcaattgcctgggtactctaaaggtcactcagattgttgcccctattctcaagcagcgc
aagcatgggttgatattgaccatgggctccttcggtggctggacacctactccttacctg
gctacctactctggcagcaaggccttcctgcagcaatggagcaatgctctttcgtctgaa
cttgctgatgaccacgtggacgtctatctggttctcagccacctagttactactgccatg
agcaaggtccgccgccctagcctcctgattcccaatgcccgtaattttgtcaaggctgct
cttggcaaggttggccttggtggttatcagactgcccccaacacttacactccttggtgg
agccactctttcatgctgtggttgattgagaacgttcccggcgtcaacagtcccgtcact
atctggtacaacaagaaaatgcacttggatattcggagacgggccctccgcaagcaggcg
cgcgaggctaagaagcagtag

DBGET integrated database retrieval system