KEGG   Metarhizium robertsii: MAA_05310Help
Entry
MAA_05310         CDS       T03107                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
maj  Metarhizium robertsii
Pathway
maj00020  Citrate cycle (TCA cycle)
maj00310  Lysine degradation
maj00380  Tryptophan metabolism
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
maj01130  Biosynthesis of antibiotics
maj01200  Carbon metabolism
Module
maj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAA_05310
  Amino acid metabolism
   00310 Lysine degradation
    MAA_05310
   00380 Tryptophan metabolism
    MAA_05310
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MAA_05310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N BioY
Motif
Other DBs
NCBI-GeneID: 19259596
NCBI-ProteinID: XP_007821499
UniProt: E9EZ61
LinkDB All DBs
AA seq 1049 aa AA seqDB search
MLRNPLCRASSQVLRGARCSAALSRSSIPTVSARTSSWKLAAVRRPLAATAARSYATDAL
HSPPDPSDNFLSGGAANYIDEMYMQWKQDPKSVHVSWQVYFKNMESGDMPISQAFQPPPN
LVPNMTGGVPRLAGNLALDDGSDVTNHLKVQLLVRAYQARGHHKANIDPLGIRNTAEGFG
NIKPKELTLEHYGFTEADLDTEYTLGPGILPRFKREGRDKMTLREIVAACERIYAGSWGV
EFIHIPDREKCDWLRERLEVPQPFKYSIDEKRRVLDRLIWSSSFESFLATKYPNDKRFGL
EGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTLGAE
DEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKTH
RTAMGVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAY
CTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQPS
FTQPLMYKRIQQKEPQIDVYVNKLLREGTFTKEDIEEHKQWVWGMLEESFDKSKDYTPTS
KEWTTSAWNGFKSPKELATEILPHHATGVDRKTLDHVGEVIGSAPEGFQIHRNLKRILTN
RTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHEQENEKTYT
PLQHISKDQGKFVISNSSLSEFGALGFEYGYSLQSPNALVMWEAQFGDFANNAQCIIDQF
IASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRIFPTEEKLARQHQD
CNMQIAYMTTPANLFHVLRRQMHRQFRKPLVIFFSKSLLRHPLARSNIEDFSGKDAGFQW
IIPDPEHQTGAIKAPEEIDRVILCTGQVWAALHKYRADNKIDNVAFTRIEQLNPFPWQQL
KENLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTQYHDRKHVMYAGRNPSASVA
TGAKHLHKKEEEDFLEMAFTVKQDKLKGE
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaatccgctctgtagagctagttcacaggtgctccgcggtgctcgatgctcc
gcagctctgtcaagaagctccatcccgacagtctctgcccgaacgtcatcatggaagctc
gccgccgtccgccgtccgctggctgcgacggccgcgaggtcctacgcaactgatgccctc
cactcgccgccggacccgagtgacaactttctgtctggaggcgctgccaattacattgat
gagatgtacatgcagtggaagcaggatcccaagagtgttcacgtgtcctggcaggtctat
ttcaagaacatggaaagtggcgacatgcccatttcccaggcttttcagccgccgccaaac
ttggttccaaacatgactgggggcgtgccccgtcttgccggcaacctagcacttgatgat
ggctctgatgttacaaatcatctgaaagtgcagctgctcgtccgcgcctaccaggcccgt
ggccatcacaaggccaacattgatcctcttggtatcaggaacactgctgagggctttggt
aacatcaagcccaaagaactgaccctcgaacactatggattcaccgaagccgaccttgac
accgaatataccctgggtcccggtattttgcctcgattcaaacgcgaaggccgtgataag
atgacactccgagaaattgtggccgcttgtgagaggatctacgccggatcctggggtgtc
gagttcattcacattcccgatcgcgagaagtgcgactggctgcgtgagcgtctcgaagtt
ccccagccgttcaagtactccattgacgagaagcgtcgcgtccttgatcggcttatttgg
agttccagcttcgagtctttcctggcaaccaagtatcctaatgataagcggtttgggctg
gagggctgcgagacccttgtccctggtatgaaggctttgattgaccgcagtgtggattat
ggtgtcaaggacatcgtcattggcatgcctcaccgtggtcgtctcaacgttctcagcaac
gttgtgcgcaaaccgaacgaatcgatcttttcagaatttgctggtacactaggtgctgag
gacgagggttcaggcgatgtcaagtaccacttgggaatgaactttgagcgtcctactccg
tcgggtaaacgcgttcagctctcactggtcgcaaacccttctcacttggaagccgaagac
cctgttgtcctgggcaagactcgagctatccagcactacaataatgatgagaagacccac
agaaccgccatgggggttctcctgcatggcgatgctgcctttgctgcccagggcattgtt
tacgaatgtttgggtttccactccctacctgccttctcaactgggggcacgattcatctt
gttgtgaacaaccaaattggcttcacaactgaccctcgattcgcccgctctacagcctac
tgcactgacattgccaaggctatcgacgcccctgtcttccacgtcaatgccgatgacgtc
gaagctgtcaactttgtttgccagctggctgctgactggcgtgccgagttccagcacgat
gttgtcattgacttaatctgctaccgaaagcatggccacaacgaaacggatcagccgtcg
ttcacccaacccctcatgtacaagagaattcagcagaaggagcctcagattgacgtctat
gtcaacaagcttttacgagaaggcactttcacaaaggaagatattgaagagcacaaacaa
tgggtttggggtatgcttgaagagagctttgacaagtccaaggactacactcccacctcc
aaggagtggactacttctgcgtggaatggcttcaagtcccccaaggagctagctacggag
atcctccctcaccacgctactggtgtggacaggaagactctagaccacgttggcgaagtc
attggctctgcccctgaaggtttccagattcatcgtaacctgaagcgcattcttaccaac
cggactaagtctgttgttgaaggaaagaatattgatttccccaccgcagaggctctagcg
tttggtaccttggtcactgaaggataccacgttcgtgtttctggccaagatgttgagcga
ggcacattctctcaacgtcatgccgtcttccatgaacaagagaacgagaagacatacacc
ccactgcagcacattagtaaggaccagggcaaatttgtcatctccaactcctccctgagt
gagtttggtgcccttgggttcgagtacggttactccctgcagtcacccaatgccctggtt
atgtgggaagcccagttcggtgactttgccaacaatgctcagtgtatcatcgaccagttt
attgcctctggagaagtgaagtggatgcagcgaactggtcttgttatgtctctccctcac
gggtatgatggtcaaggccccgagcactcgtctggtcgtctggaacgttatctccagttg
tccaacgaggatcctcgtattttcccgactgaggagaagcttgcgagacagcaccaagac
tgcaacatgcagattgcctacatgacaaccccagccaacttgttccatgttctgcgccga
cagatgcaccgacagttccgaaagcctcttgtcatatttttctccaagtctttgctccgc
cacccgctcgctcgctcaaatattgaggatttcagtggcaaggatgctggcttccagtgg
attatccctgatcctgagcatcaaactggtgcaatcaaggcccctgaggagattgaccgc
gtcattctgtgcactggtcaggtctgggctgccctacataagtaccgagccgacaacaag
attgacaacgtggctttcacccgcattgagcagctaaacccattcccttggcagcagctg
aaggagaacctcgacatgtaccctaacgccaaaaccattgtctgggctcaggaggaacct
ctcaacgctggtgcttggagcttcacccaaccccgcattgagactcttctcaaccagacc
cagtaccacgaccgaaaacatgtcatgtacgctggccgtaatccgagtgcgtctgttgcc
actggcgcgaaacatctgcacaagaaagaagaagaggatttcttggaaatggctttcacc
gtgaagcaggacaagctgaagggcgagtaa

DBGET integrated database retrieval system