KEGG   Metarhizium robertsii: MAA_05673Help
Entry
MAA_05673         CDS       T03107                                 

Definition
(RefSeq) Succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
maj  Metarhizium robertsii
Pathway
maj00020  Citrate cycle (TCA cycle)
maj00190  Oxidative phosphorylation
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
maj01130  Biosynthesis of antibiotics
maj01200  Carbon metabolism
Module
maj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
maj_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAA_05673
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MAA_05673
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MAA_05673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 19259959
NCBI-ProteinID: XP_007821862
UniProt: E9F074
LinkDB All DBs
AA seq 651 aa AA seqDB search
MQLLDQKAEAKQRLKAANGCALIGQMNRGTEHACSETRVIANHPLRAKEASPHVSTKYNV
IDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHED
DWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELEHYGCPFSRTEEGKIYQRAFGGQS
QKYGKGGQAYRCCAAADRTGHALLHTLYGQSLAHNTNYFIEYFALDLIMQDGECRGVLAY
NQEDGTLHRFLANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHP
TGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGV
GAEKDHIFLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRY
TGEVLTVDEQGKDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFK
PGEKLKPLAADAGSDHIEVLDQVRTSDGPKSTAEIRLAMQKAMQTDVSVFRTQESLDEGV
RKMNAIDPMFKEVGIKDRSMIWNSDLVETLELRNLLTCATQTATAAAARKESRGAHARED
YPDRDDKNWMKHTLSFQKTPHGKVDLTYRGVISTTLDENECKPVPPFKRVY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgcagctattggaccaaaaggcagaggccaaacagcgcctgaaggctgctaatggctgc
gcgctgattggccaaatgaaccgaggaaccgagcacgcttgttccgaaactcgagttatt
gccaaccatcccctgagagccaaggaggcttctcctcatgtcagcacaaagtacaacgtc
attgaccacgagtacgatgccctcgtcgtcggcgccggtggtgctggtctccgtgccgcc
tttggtctcgccgaggctggcttcaacactgcctgtatctcgaagctgtttcccactcga
agtcacactgtcgccgcccagggtggcatcaacgctgctctcggcaacatgcacgaggat
gactggagatggcacatgtacgataccgtcaagggctctgactggctgggcgaccaggat
gctatccattacatgacccgtgaggctcccgcctccattatcgagcttgagcactatggt
tgccccttctcccgaaccgaggagggaaaaatctaccagcgagctttcggtggacagtcc
cagaagtacggcaagggcggccaggcctaccgatgctgcgccgcagctgaccgaaccggc
cacgctcttctgcatactctctacggccagtcccttgcccacaacaccaactacttcatc
gagtattttgctctggatctgattatgcaggatggcgaatgccgcggtgtcctcgcctat
aaccaggaggatggtactctgcaccgattccttgccaacaacactgtcctggctaccggt
ggttatggccgtgcgtactttagctgcacgtctgctcatacttgcactggtgacggcatg
gccatggttgcccgtgctggtctccccaaccaggatctcgagtttgttcaattccatcct
accggcatctacggtgccggctgcctgatcactgagggtgctcgtggtgaaggtggttac
ctgctcaactctgagggtgaacgttttatggagcgttacgcgcctactgctaaggatttg
gcctctcgtgatgtcgtttctcgatccatgaccatggaaattcgtgatggccgtggtgtc
ggtgctgagaaggatcacatcttcctccagctcagccacttgcctgccgaaattcttgct
gagcgtctgcccggtatctccgagaccgctggtatcttcgctggcgtcgatgtccgaaag
caacctattccggtcttacctactgtccactataacatgggcggtatcccgacccgctac
accggtgaggtgcttaccgtcgatgagcagggcaaggacaaggttgttcccggtctgttc
gcctgtggtgaggctgcctgcgtgtctgtccacggtgctaaccgtcttggcgccaactct
ctgctggatcttgtcgtcttcgggcgtgcagtttcgcacactatccgtgacaacttcaag
cctggggagaagctcaagcctcttgctgctgatgctggttctgaccatattgaggttttg
gaccaggttcgaacctctgacggccccaagagcactgctgagatccgtctggccatgcag
aaagctatgcagactgatgtctcagtgttccgaactcaggagagtttggacgagggcgtt
cgtaagatgaacgcaattgaccccatgttcaaggaagttggcatcaaagaccgcagcatg
atctggaactctgatctcgtcgagactctggaactgcgaaacctcttgacttgcgctacc
caaactgctactgccgccgctgcccgaaaggagtcccgtggtgcccacgctcgcgaggat
taccccgaccgtgacgacaagaactggatgaagcacactctatccttccagaaaacgcct
cacggcaaggtcgacctgacataccgtggcgttatttcaaccactctggatgagaacgag
tgtaagcctgtacctccctttaagcgtgtatactaa

DBGET integrated database retrieval system