KEGG   Metarhizium robertsii: MAA_06310
Entry
MAA_06310         CDS       T03107                                 

Definition
(RefSeq) hypothetical protein
  KO
K02606  origin recognition complex subunit 4
Organism
maj  Metarhizium robertsii
Pathway
maj04111  Cell cycle - yeast
maj04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:maj00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    MAA_06310
   04113 Meiosis - yeast
    MAA_06310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:maj03032]
    MAA_06310
DNA replication proteins [BR:maj03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    MAA_06310
SSDB
Motif
Pfam: ORC4_C AAA_16 PHD_2 PHD AAA_22 AAA NACHT ATPase_2 AAA_19 AAA_30 FYVE_2 NB-ARC AAA_14 KAP_NTPase SMC_N zf-RING_9 AAA_29 AAA_18 AAA_7 cobW AT_hook TniB ABC_tran C1_1 DUF815 FtsK_SpoIIIE AAA_33 G-alpha ATP_bind_1 T2SSE TIP49 AAA_25 AAA_5 RNA_helicase AAA_24 PIF1 Mg_chelatase Prok-RING_1 MeaB Sigma54_activat MobB NTPase_1 zf-UDP C1_2
Other DBs
NCBI-GeneID: 19260596
NCBI-ProteinID: XP_007822499
UniProt: E9F2B2
LinkDB
AA seq 770 aa
MDQDVTPTGRKRSVDDIENDIIPDPIKRRKLDDAAAGSPSTPKALKAIASAISGVFGAGR
QSRKEVNGTEPSLTATSTQPKPLLSTNKKNGRLLNPAAPAAPAAPAPPASSPLKRPAIKI
AALRGTIWDNGDLPESKKCTVPKRPVKQAGVGNRYQGPLPPASVYQPKEATASAQKPGSI
AGNKAQPPKGILTPTKKRGRPRKNVTFNGGADGEVYFDDLPKTSTARKPKAAKAQMAQQE
DDGIVCEMCYKPDSIAPNEIILCDNCDFAVHQQCYDIAEVPEGDWLCKSCSQEDVLKAPG
EPTPKTNEPSYPVEVPDIPNLDHHLRGFQRVLLDRCSGRRRIRMFGQEEPYEKVRQLIEQ
TVMAGEGNSMLVIGPRGSGKTTLVENIIVDLSKEHGHEFHVVRLNGFIHTDDKLALKEIW
RQLGKEMEVEDDLLNRINYADTMASLLALLSHPSEIMGTDENLTSQSVVFIIDEFDMFAS
HPRQTLLYNLYDIAQSRKAPIAVLGCTTRIGVVDMLEKRVKSRFSHRYVYLAPPKSLPAF
WQICRQGLMIDKPDVESEGVDVHTEGYIEFHKYWTQKIEELYKQRQFQHLLQYHYFTTKS
AAAFFTEWISPLSSLSSRNLTMNSPTALSPTTSLAPPDSRMQLLSTLSYLELGLLIAAAR
LDIVAHTDTVNFAMAYDEYSSLVGKQRVQSSTAGMLAMGGSARAWSRGVAGVAWERLIAL
GLLVPAGIGGGRSLGHGGLDSKMWKVDVALEEIPTAVKLSTTLARWCREI
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggatcaggatgttaccccgactggccgaaagcgatcggtggacgacatcgaaaatgat
ataatacccgacccgatcaagaggagaaagttggatgatgcagcagctggctcaccctcg
acccccaaagcccttaaagccattgcctcagctatctcgggcgtttttggagccggccgc
cagtctcggaaagaggtcaatggcaccgaaccatctttgacggctacttcgacccaacct
aagcctctcctcagcaccaacaaaaaaaatggtcgtttgctcaacccagctgctcccgct
gctcccgctgctcctgctcctccagcttcatcaccgttgaaacggcccgccatcaagata
gcagcattgagaggaacaatatgggacaatggcgatcttcccgaatcaaaaaaatgtact
gttccaaagcgtccagtcaagcaagccggggtgggaaataggtatcagggtccattgccg
cccgcatctgtctaccagcccaaggaggcgacagcatccgcccagaagccgggctctatc
gctggcaacaaagcacaaccgccaaagggcattcttacaccaaccaagaaacgaggccgg
ccacgcaaaaacgtcacctttaacgggggtgccgatggcgaagtatactttgatgatcta
cccaagacctcgaccgcaagaaaaccaaaagcggccaaagcgcaaatggcacagcaagag
gacgacggtatagtctgcgagatgtgttacaagccagactcaatagcgccaaacgagatt
atactttgcgacaattgcgattttgccgtgcatcagcaatgctacgatatcgcagaggtc
cccgaaggcgactggttgtgcaaatcttgctctcaggaagatgtgctcaaggcgccaggc
gagcccacccccaaaacgaacgaaccttcatatccggtcgaggtgcccgacataccgaac
ctggatcatcacctgcgagggtttcagcgtgtgctcttggaccgatgctcgggacggcgg
cggatacggatgttcgggcaggaggagccgtatgagaaggttaggcagcttattgaacaa
actgttatggcgggagagggtaactcaatgttggtcattggaccacgtggctctggcaag
acgacgttggtggaaaacatcatagttgacctatcaaaggaacatgggcatgagtttcac
gtagtacggctcaatgggttcatccacactgatgacaagttggccctgaaggaaatttgg
cgacagcttggaaaggagatggaggttgaagacgacctactgaaccggataaactacgca
gatacgatggcatcgcttctggctctgctctctcacccatccgaaatcatgggcaccgac
gaaaacctcacatctcagtcggtagtgttcatcattgacgagtttgacatgtttgcgtcc
catcccagacagaccctactgtataatctttacgacattgcgcagtctcgcaaggctccg
attgccgttttgggttgcaccactcgtattggcgtagtagacatgcttgagaagagagtc
aagagtcgttttagccaccgctacgtgtatctcgctccacccaaatctctgccggcattc
tggcagatttgtcgccagggccttatgattgacaaacctgatgttgagagcgaaggtgta
gatgttcacacggagggctacattgagtttcataaatattggacccaaaagatagaggaa
ctctacaagcaacggcaattccaacacttgctacaatatcattactttacaacaaagtct
gcggcggccttctttacggaatggatatcgcctctttcttcgctctcgtcaaggaacctc
acaatgaacagcccgacagcattgtcgccgacgacttcgttggctcccccagactcacgg
atgcaattgctgtccaccttgtcgtatcttgagctgggactactcatcgccgcggcgagg
ttagacattgtggcgcacacggacacggtcaattttgccatggcatacgacgagtacagc
tcgctggtgggcaaacaacgagtccaatcgtcgacggcgggcatgctggccatgggcggc
agcgcgagggcatggagccgtggtgttgcaggagtggcctgggagaggttgattgcgcta
ggattgttggtgcctgctggaatcggcggcggcaggtccctcggacatggagggctggac
agcaaaatgtggaaggttgatgttgcgctggaggagattccgacggcagtcaagctgagc
acgaccctggcaagatggtgccgggagatatga

DBGET integrated database retrieval system