KEGG   Metarhizium robertsii: MAA_07845Help
Entry
MAA_07845         CDS       T03107                                 

Definition
(RefSeq) Glycoside hydrolase, family 31
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
maj  Metarhizium robertsii
Pathway
maj00052  Galactose metabolism
maj00500  Starch and sucrose metabolism
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MAA_07845
   00500 Starch and sucrose metabolism
    MAA_07845
Enzymes [BR:maj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MAA_07845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 19262131
NCBI-ProteinID: XP_007824034
UniProt: E9F6E6
LinkDB All DBs
AA seq 522 aa AA seqDB search
MKLWTSVLFSGLASAGALVNRDGDKALAKCPGYTASNVKTSGSGLTAHLTLAGKACDAYG
DDLKQLVLQVTYETDDRLHVKIQDKDNQVYQVPESVFPRPGGSSSASANRLRFDYTASPF
SFQVSRRDTHEVLFDTSAAPLVFESQYVRLRTKLPQDPYLYGLGEHSDAFRLNTTGYIRT
LWNQDSYGIPAGANLYGAHPIYLEHRDGGSHGVFLLNSNGMDVVIDKARDGGQYLEYNTL
GGVLDLWFFAGKTPTAVVQQYTEIAGRPAMPPYWGLGFHQCRYGYQDVFDVAEVVYNYSK
ANIPLETMWTDIDYMDRRRVFSLDPERFPLHKMRALVSHLHARDQHYVVMVDPAVAYQDY
APLTAGLEQDVFLKRANGSAWLGVVWPGVSVFPDWFARNAGAYWDAMFGRFFHRDTGLLV
ALDASGRARGELYLDDGVSLDQRARYSLVTFAFDAASGRLEVGGVFDYPGPPARVSKITL
LGSEGRDPAPAQTHALGGSRVYSRSFDVDWTLDRAATYTVGK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctggacgagcgtgctcttttcaggcctcgcctctgcgggcgccctggtcaac
cgcgatggggacaaggccctggccaagtgtcccggctacacggcgtccaacgtcaagacg
tctggatccgggctgacggcccatctcacgcttgcgggcaaggcttgcgacgcgtacggc
gacgacttgaagcagcttgttttgcaagtcacctacgagaccgacgaccggctccacgtc
aagatccaggacaaggacaaccaagtataccaggtgcccgagtccgtcttcccgcggccc
ggcggctcgtcgtcggcatcggcaaaccggctccggttcgactacacggcgtcgcccttt
tccttccaggtcagccgccgcgacacgcacgaggtgctcttcgacacgtcggcggcgccg
ctcgtcttcgagtcgcagtacgtgcggctgcgcaccaagctgccgcaggacccgtacctc
tacgggctcggcgagcactcggacgccttccggctcaacacgacgggctacatccgcacg
ctctggaaccaggacagctacggcatccccgcgggcgccaacctgtacggcgcgcacccc
atctacctcgagcaccgggacggcggctcgcacggcgtcttcctcctcaactccaacggc
atggacgtggtcattgacaaggcccgcgacggcggccagtacctcgagtacaacacgctc
ggcggcgtgctcgacctttggttctttgccggcaagacgcccaccgccgtcgtccagcag
tacaccgagattgcgggccgcccggccatgccgccgtactgggggctgggcttccatcag
tgccgatacggctaccaggacgtgtttgacgtggccgaggtcgtctacaactacagcaag
gccaacatcccgctcgagaccatgtggacagacattgactacatggaccggcggcgcgtc
ttctcgctcgacccggagcgcttcccgctgcacaagatgcgcgcgctcgtgtcgcacctg
cacgcgcgcgaccagcactacgtcgtcatggtcgacccggccgtggcctaccaggactac
gcgccgctgacggcgggcctcgagcaggacgtcttcctcaagcgcgccaacggctccgcg
tggctgggcgtcgtgtggcccggcgtgtccgtcttcccggactggttcgcgcgcaacgcc
ggcgcctactgggacgccatgtttggccgcttcttccaccgcgacacgggcctgctcgtc
gcccttgacgcgagcggccgcgcccgcggcgagctgtacctcgacgacggcgtctccctc
gaccagcgcgcccgctactccctcgtcacctttgcctttgacgccgcctccggccgcctc
gaggtcggcggcgtcttcgactaccccggccctcctgcgcgcgtgagcaaaatcaccctc
ctggggtccgagggccgcgaccccgcgcccgcccagacgcacgccctcggggggtctcgt
gtctacagccgctcattcgacgtcgactggacgctggatagggctgccacgtacacggtt
ggcaagtga

DBGET integrated database retrieval system