KEGG   Metarhizium robertsii: MAA_07869Help
Entry
MAA_07869         CDS       T03107                                 

Definition
(RefSeq) elongation of fatty acids protein 3
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
maj  Metarhizium robertsii
Pathway
maj00062  Fatty acid elongation
maj01040  Biosynthesis of unsaturated fatty acids
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
maj01212  Fatty acid metabolism
Module
maj_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    MAA_07869
   01040 Biosynthesis of unsaturated fatty acids
    MAA_07869
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maj01004]
    MAA_07869
Enzymes [BR:maj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     MAA_07869
Lipid biosynthesis proteins [BR:maj01004]
 Elongase
  LCFA
   MAA_07869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 19262155
NCBI-ProteinID: XP_007824058
UniProt: E9F6H0
LinkDB All DBs
AA seq 344 aa AA seqDB search
MSGFFEQLPLPTIDRPFGVHLWPIFSKAWEAVVGYPAEEFKFVPFETPMSTLKSTSIFIV
VYYMIIFGGRELMRSREPFKLKALFLIHNFYLTAISGILLVLFIEQLVPELYHNGVFHAI
CHYDGGWTQPMVVLYYLNYLTKYLELLDTVFLFLKKKPLTFLHCYHHGATALLCYTQLIG
STSVSWVPITLNLTVHVVMYWYYFQSARGIRIWWKEWVTRLQIIQFIIDLGFVYFASYTY
FTSTYFPWLPNAGKCAGEEFAAFSGIAILSSYLVLFISFYFATYKKGGKSTTRKSLRRMS
QAPLPDPLHVQAAVAANGKSNGYTNGATTTGAKAHGAATRSRKA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcttctttgagcagctcccgctgcctacgatcgaccgccctttcggcgtccat
ctatggcccatcttcagcaaggcctgggaggctgttgttggatatccggctgaggagttc
aagtttgttccttttgagactcccatgtcgactctcaagtcgacctccatcttcatcgtt
gtttactacatgatcatttttggtggccgcgagttgatgcgcagccgtgagcccttcaag
ctcaaagctctgttcctcatccacaacttctacctcactgccatcagcggtattctcttg
gtcctcttcattgaacaattggttcccgagctctaccataatggtgtcttccatgccatc
tgccactatgatggcggttggacccaacctatggttgtcttgtactacctaaactacctg
accaagtatcttgagttgttggacactgtcttcctcttcttgaaaaagaagccgttgacc
ttcctccactgctaccaccacggtgctactgctcttctctgctacactcagctcattggc
tctacctctgtctcttgggttcccatcaccctgaacctgactgttcacgtcgtcatgtat
tggtattatttccagagcgctcgtggcatccgcatttggtggaaggagtgggtcactcgt
ctccagatcatccagttcatcattgacctcggttttgtctacttcgcctcatacacctac
ttcacgtcgacctactttccatggctgccaaatgccggcaagtgcgctggtgaggaattt
gccgcgttctctggtattgccatcctcagctcgtatctggtcctcttcatctccttctac
ttcgccacctacaagaagggcggtaaaagcaccacgcgcaagtctttgcgacgcatgtcc
caggctcctcttcccgaccctctgcacgtccaggctgcggtcgctgctaacggcaagagc
aacggctacactaacggtgccaccaccactggggcgaaggctcacggtgccgctactcgc
tctcgcaaggcataa

DBGET integrated database retrieval system