KEGG   Metarhizium robertsii: MAA_08526Help
Entry
MAA_08526         CDS       T03107                                 

Definition
(RefSeq) Glutathione S-transferase/chloride channel
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
maj  Metarhizium robertsii
Pathway
maj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MAA_08526
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maj02000]
    MAA_08526
Enzymes [BR:maj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MAA_08526
Transporters [BR:maj02000]
 Other Transporters
  Pores ion channels [TC:1]
   MAA_08526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 19262812
NCBI-ProteinID: XP_007824715
UniProt: E9F8C7
LinkDB All DBs
AA seq 213 aa AA seqDB search
MSGLKPLTLWIHAQGPNPKKVLIVLEELGVPYESITIHKPKDASFLAINPNGRLPAIQDP
NNNDLILWESGAIVEYVVETYDKENKLTFASNPEKWFLKQFLHFQMSGQGPYFGQASWFR
VYHPEDVPSAKKRYADETVRVIDVLNTILEGKKYLVGEKFTYADLVFIPWDEVVRVYIKD
IWEGYEIEQKYPNFLAWHNRLMERRSVKKAYGA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtcttaagccccttactctttggattcacgcccaaggccctaatcccaagaaa
gttctcattgtcctcgaggagttgggtgttccctacgaatctatcacgattcataagcct
aaagatgcttccttcttggctatcaaccctaacggtcgccttcccgccattcaggaccct
aacaacaacgacctcattctgtgggaatcgggtgccatagtcgagtatgttgtcgagact
tatgacaaggagaacaaattgacatttgcgagcaatcccgagaaatggttcctcaagcaa
ttcctgcattttcaaatgtcagggcagggcccatattttggtcaggcttcgtggttccga
gtgtatcatcccgaggatgttcccagtgccaaaaagcgctatgctgatgagactgtgagg
gtcattgacgtccttaacactatactggaaggcaagaagtatcttgttggcgagaagttt
acatatgccgacctcgtatttatcccttgggatgaagtggtgagggtttatatcaaagat
atctgggagggctatgagattgagcagaagtatcctaacttcctagcctggcataaccgt
cttatggagcgccgctcggtgaagaaggcgtatggtgcttaa

DBGET integrated database retrieval system