KEGG   Metarhizium robertsii: MAA_09935Help
Entry
MAA_09935         CDS       T03107                                 

Definition
(RefSeq) DNA ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
maj  Metarhizium robertsii
Pathway
maj03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:maj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MAA_09935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:maj03400]
    MAA_09935
Enzymes [BR:maj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MAA_09935
DNA repair and recombination proteins [BR:maj03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MAA_09935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N RNA_ligase BRCT_2 DNA_ligase_A_C BRCT DNA_ligase_IV LIG3_BRCT mRNA_cap_enzyme Bac_globin PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 19264221
NCBI-ProteinID: XP_007826124
UniProt: E9FCD6
LinkDB All DBs
AA seq 987 aa AA seqDB search
MSGFNRAKSPDADAEREEEMQYGAVGLTKEELEEKYPNRPHNHSKTLLFSELFLQLFNPL
NENKKQPAAGPARKKGPHGATTLSPQEQRRHIIERFINRWRKEVGNDFYPALRLILPDKD
RDRGVYGLKENAIGKLLVKLIKIDKNSEDGYNLLHWKLPGQTMAARLAGDFAGRCYEVIS
KRPMRIEVGDMTIAEVNEQLDKLAASAGEAENLRVFETFYNRMNAEEMLWLIRIILKQMK
VGATEKTFLYLWHPDGETLFSVSSSLRRVCWELYDPDVRLEQEEAGISLMQCFQPQLAQF
QMPASFQKMTELLRPTEDDAEFWIEEKLDGERMQMHMVADASHPGGKRFCFWSRKAKDYT
YLYGDGVLDENSSLTRHLKDAFAPGVRNLILDGEMITWDMAVDKIVPFGTLKTAAIAEQQ
NKSGSDASGHRPLYRVFDIVYLNDKPLTQYTLRDRHRALEKAIRPVHRRLEIHAYKSATT
ADAIEPMLREVVASASEGLVLKNPRSMYRLNSRNDDWLKVKPEYMSEFGESLDCLVIGGY
YGSGKRGGTLSSFLCGLRVSPNHIQAGDNPEKCYSFFKVGGGFRGEDYAEIRHRTEGKWV
EWDRRNPPTEYVELGGGEGRQLERPDVWIRPRDSVVLSAKAASVGPSDSFAMGYTLRFPR
FRRLRLDRAWDSALSVDEFEELKRQVDREAREKAMTVEDRKRRHPKRAKRSVVIAGEDAT
AVASRGAASHVFDGLEFCVLSESLRPWRKTKAQLEAVIKENGGTVSQRAVAGTRMVLVAD
KNVVKVASLIKGGNANIIRPKWIRDCVEQGGDFLLPYEEGHLFHATEALGAVAAKNTDMY
GDSYARDVSVDELRGIVGAMPKVEEAFDGDRFLAELEERGKGIAELRGFMMRRCVVHFRA
VDGVDGPTGKLVHYVMYTGGKVVDSLREGVTHVVVVGDDAMQVGEAADTARRQVSSWAKV
PRVLGHGWVLDCWKERTLLDEEKYVIS
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcttcaacagggccaagtcgccagatgccgatgccgagcgtgaggaggaaatg
cagtatggcgcagtcggcttgacgaaagaagagctcgaggaaaagtacccaaacaggccg
cacaatcactccaaaaccctgctcttttccgagctgttcctccagctctttaacccgctc
aatgagaacaagaagcagccagcggctggtccggctcgcaagaagggccctcacggcgca
actacgctctcgccgcaagagcagagacgccacatcatcgagagattcatcaacaggtgg
cgcaaagaagtcggcaacgacttctatcccgcgctgcggctgattctgcccgacaaggac
cgcgaccgtggtgtctacgggctcaaggagaacgccatcggcaagctactggtaaagctc
atcaagattgacaaaaactctgaagatggctacaatctcttgcactggaagctgcccggc
cagacaatggcggctcgactggctggcgactttgccggccgatgctacgaggtcatttcc
aagagaccgatgcggatcgaggtgggcgacatgaccattgccgaggtaaatgagcagctg
gacaagttggccgcatcggctggagaggcggaaaacctgagggtatttgagacgttttac
aaccgcatgaacgccgaggagatgctgtggctcatccgcatcatcctcaagcaaatgaag
gtcggtgccacagagaagactttcctctacctgtggcacccggacggcgagacgctattc
agcgtgtcgtcgagcctgaggcgcgtgtgttgggagctgtacgacccggatgtcaggctg
gagcaggaagaagccggcatatcgctgatgcagtgcttccagccgcaactggcccagttc
cagatgcccgcctcttttcaaaagatgacggagctgctgcggccgacagaggatgacgcc
gagttttggatcgaggagaagctggatggggagcgaatgcagatgcacatggtggctgat
gcctcccaccccggaggcaaacgcttttgtttctggtcgcgcaaggcaaaggactacaca
tacctatacggcgacggcgtactggacgaaaactccagcttgacgcgccatttgaaagac
gcctttgcccccggtgttcggaatctcatactggacggggagatgatcacatgggacatg
gcggtcgacaagatcgtcccctttggcaccctgaaaaccgccgccattgcagagcagcag
aacaagtcgggctccgacgcatccggtcaccggcccttgtatcgcgtctttgacatagta
tacctcaacgacaagcctctcacgcagtacacccttcgcgaccggcaccgcgccctcgaa
aaggcaatcaggcccgttcaccggcggctcgaaatccacgcgtacaagagcgccacgacg
gccgacgccatcgagcccatgctccgagaggtcgtggccagcgcctccgaaggcctggtg
ctgaagaacccacgctccatgtacagactcaacagccgcaacgacgactggctcaaggtg
aagcccgagtacatgtccgagtttggcgaatcgctcgactgcctcgtgataggcgggtac
tacggctccggcaagcgaggcggcacgctgtccagcttcctgtgcgggctccgcgtgtcc
ccgaaccacatacaggccggcgacaaccccgaaaaatgctacagcttcttcaaggtgggc
ggcgggttccgcggcgaggactacgccgagatacggcaccgcaccgagggaaaatgggtc
gagtgggacaggaggaacccgccgaccgagtacgtcgagctcggcggcggggagggcagg
cagctcgagcggccggacgtgtggatccggccgcgggactcggtcgtgctctccgcaaag
gcggccagcgtcggcccctccgacagcttcgccatggggtacacgctgcggttcccccgg
ttccgccggctgcgcctcgaccgcgcgtgggactcggcgctgtcggtggacgagttcgag
gagctcaagcgccaggtggaccgggaggccagggagaaggccatgacggtggaggacagg
aagcgcagacaccccaagcgcgccaagaggagcgtcgtgattgcgggcgaggacgcgacg
gccgtggcgtcccgcggcgcggcgtcgcacgtctttgacggtctcgagttttgcgtgctc
tccgagtcgctcaggccgtggaggaagacaaaggcgcagctggaggccgtcatcaaggaa
aacggcggcaccgtctcgcagcgggccgtcgcgggcacgcgcatggttctcgtagcggac
aagaatgtcgtcaaggtggcgagcttgatcaagggcggcaacgccaatattatacgcccc
aagtggatcagggactgcgtcgagcagggtggcgattttctgctgccctacgaggagggc
cacctgtttcatgcgaccgaggcgctgggcgctgttgcggccaagaacacggacatgtac
ggggatagctatgcgcgcgacgtctcggtggacgagctgagggggattgtgggcgccatg
cccaaggtggaggaggcctttgacggggaccgttttttggccgagctggaagagaggggc
aagggcatcgcggagctgagagggttcatgatgaggcggtgcgtggtgcattttcgagcc
gtggacggcgtggacgggccgacggggaagctggtccattatgtcatgtacacgggcggc
aaggtcgtggacagcctgcgcgagggcgtcacgcacgtggtggtcgtgggagacgacgcc
atgcaagtcggggaggcggcggacacggccaggagacaagtgagctcctgggccaaggtg
ccgcgtgttttgggacatgggtgggttctagactgctggaaggagaggacattgctagac
gaggagaagtatgtgatttcatag

DBGET integrated database retrieval system