KEGG   Mycobacteroides abscessus subsp. bolletii MM1513: LH56_02645Help
Entry
LH56_02645        CDS       T03341                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mak  Mycobacteroides abscessus subsp. bolletii MM1513
Pathway
mak00220  Arginine biosynthesis
mak00250  Alanine, aspartate and glutamate metabolism
mak00290  Valine, leucine and isoleucine biosynthesis
mak01100  Metabolic pathways
mak01110  Biosynthesis of secondary metabolites
mak01130  Biosynthesis of antibiotics
mak01210  2-Oxocarboxylic acid metabolism
mak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH56_02645
   00290 Valine, leucine and isoleucine biosynthesis
    LH56_02645
   00220 Arginine biosynthesis
    LH56_02645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mak01007]
    LH56_02645
Enzymes [BR:mak01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LH56_02645
    2.6.1.66  valine---pyruvate transaminase
     LH56_02645
Amino acid related enzymes [BR:mak01007]
 Aminotransferase (transaminase)
  Class I
   LH56_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIR41501
LinkDB All DBs
Position
complement(555773..557083)
Genome map
AA seq 436 aa AA seqDB search
MDSNATIETVSTDNLPIDVPPRVPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAHAARLE
AEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILPARRAVVTRYELVD
GFPYLDVDDVFLGNGVSELITMTTQALLDNGDQVLIPAPDYPLWTAATSLAGGTAVHYLC
DETNGWMPDIEDLESKITERTKALVIINPNNPTGAVYSREILTKMVELARKHQLLLLADE
IYDKILYDDAEHISVASLAPDLLCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGV
NLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKP
QGALYAFPRLDPEVHHIHDDDQLVLDLLLNEKILLTQGTGFNWPEPDHLRIVTLPWARDL
AVAIERLGNFLASYRQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ctggacagcaatgccaccattgagaccgtgagtaccgataacttgccgattgacgtgccc
ccgcgcgtgcccggcctttcgccgcggcagcatcagcgggtcttcgcgcagtccaccaag
ctacaagacgtcctgtacgaaatcaggggtccggtacacgcacacgccgcccggctcgag
gccgagggtcatcgcatcctcaagctcaacatcggcaaccctgcgccgttcggattcgag
gcgcccgatgtcatcatgcgcgacatcatccaggcgctcccctacgcacagggctactcc
gactccaagggcatcctgcccgcccggcgcgcggtggtcacccgctacgaactggtcgac
gggttcccgtacctggatgtggacgacgtcttcctgggcaatggggtatccgagctgatc
accatgaccacccaggcgctgctcgacaacggcgaccaggtgctcatcccggcgcccgac
tatccgctgtggaccgccgcgacctcacttgccggcggcaccgcggtgcattacctgtgc
gacgagaccaacggctggatgcccgatatcgaggatctggaatccaagatcaccgagcgc
accaaggccctcgtcatcatcaacccgaacaacccgaccggcgcggtatatagccgcgag
atcctcacgaagatggtcgaactggcccgcaagcatcagttactgctgctggccgacgag
atctacgacaagatcctgtacgacgacgccgagcacatcagcgtcgcgtcacttgccccg
gatctgttgtgtttcaccttcaacggcctgtccaaggcatatcgagtggctggctaccgg
tcagcatggcttgccatcaccgggcccaaggaccacgccgccagcctgctggaaggcgtg
aacctgctggccaatatgcgactgtgcccgaatgttcctgcccagcatgcgattcaggtg
gccctcggtggacaccagagcatcgaggatctggtgttaccgggtggtcgcctgctggag
cagcgcgatgtcgcctggacaaagctcaacgagatccccggtgtctcctgcgtcaagccg
cagggtgcgctctacgcgttcccgcgcctggaccccgaggtgcaccatatccacgacgac
gaccagctcgtcctggatctgctgctcaacgagaagatcctgctgacgcagggcaccggc
ttcaattggcctgagcccgaccatcttcggatcgtcacgttgccatgggcccgcgacctt
gccgtcgccatcgagcgcctgggcaacttcctggcgagctaccgccagtag

DBGET integrated database retrieval system