KEGG   Mycobacteroides abscessus subsp. bolletii MM1513: LH56_07680Help
Entry
LH56_07680        CDS       T03341                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mak  Mycobacteroides abscessus subsp. bolletii MM1513
Pathway
mak00473  D-Alanine metabolism
mak00550  Peptidoglycan biosynthesis
mak01100  Metabolic pathways
mak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mak00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LH56_07680
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LH56_07680
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LH56_07680
Enzymes [BR:mak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LH56_07680
Peptidoglycan biosynthesis and degradation proteins [BR:mak01011]
 Precursor biosynthesis
  Amino acid ligase
   LH56_07680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AIR42480
LinkDB All DBs
Position
1574466..1575599
Genome map
AA seq 377 aa AA seqDB search
MGRSRADQQRIKVALVFGGRSSEHAISCVSAGSILRNLDQAVYEVVAVGVTPEGGWVLTD
GDPAQLAISDRTLPQVTDASGTELLLATDPRRAGQLVNVDSSAAGQVLASVDVVFPVLHG
PYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLLAAEGLPIGKYAVIRPRDTTL
TLDQREDLGLPVFVKPARAGSSFGVSRVTAWEELPAAIAHARQYDPKVIVEAAIVGRELE
CGVLEFPDGDTRASVLGEIRVEGVNRDQTAAGAFYDFETKYLDDTAELDVPAKVDDDVSD
QIRELAVAAFRAIDCQGLARVDFFLAEDGPLINEINTMPGFTTISMYPRMWDATGVDYPT
LLDAMVRTALARGTGLR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgctcgcgcgcagaccaacagcggatcaaggtcgcgctcgtctttggcgggcgc
agcagtgagcacgcgatctcgtgcgtgtccgccggcagcattctgcgcaatctggaccag
gccgtctatgaggtagtcgccgtgggggttactcccgagggcggttgggtgctgaccgat
ggcgaccccgcgcagctggcgatcagcgacaggacgctgcctcaggtcaccgacgcatcc
ggcaccgagttgttgctcgccaccgatccgcggcgagcggggcagctggtgaacgtggac
tcgagcgccgccgggcaggtgctggcctcggtcgatgtggtgttcccggtgctgcacggt
ccctatggcgaggatggcaccattcagggactgttggagctggccggggtgccctacgtg
ggtgccggtgtgctcgcgagtgcggccggtatggacaaggagttcaccaagaagctgctg
gcggccgaggggctcccgattggcaagtacgccgtgatccgcccgcgcgacaccacgctg
acgctggatcagcgcgaggacctggggctgccggtattcgtcaagcccgctcgggcggga
tcgtcgttcggtgtgtcccgggtgaccgcctgggaggaactacctgccgcgatcgcacac
gcgcgtcagtacgacccgaaggtgattgtcgaggcggcgatcgtcggccgcgaactggag
tgcggagtgctggagttccccgacggggatactcgggccagcgtgctcggcgaaatccgg
gtcgagggagtgaatagggaccagacggctgcgggtgccttctacgacttcgagaccaag
tacctggacgacaccgccgaattggacgtaccggccaaggtcgacgacgacgtgagcgat
cagatccgcgaacttgccgtggccgcgttccgggcgatcgactgccaggggctggcccgg
gtcgatttcttcctcgccgaggatggcccgctgatcaatgagatcaacaccatgccgggg
ttcaccaccatctccatgtacccgcggatgtgggatgcgaccggcgtggactatccgacg
ctgctggacgctatggtgcgcaccgcgctggcgcggggtaccggccttcgctga

DBGET integrated database retrieval system