KEGG   Mycobacteroides abscessus subsp. bolletii MM1513: LH56_21765Help
Entry
LH56_21765        CDS       T03341                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mak  Mycobacteroides abscessus subsp. bolletii MM1513
Brite
Enzymes [BR:mak01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LH56_21765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIR45168
UniProt: A0A1N5GLW8
LinkDB All DBs
Position
4386969..4387592
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAVAKLEEAREKGDHAAIF
LNEKNLAFHLGGHVNHSIWWKNLSPNGGDKPTGDLAAAIDDQFGSFDKFQAQFTAAANGL
QGSGWAVLGYDSLGQKLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWADVQDRYTAATTKTSGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagtacacactgcccgatttggactatgactacggagcgctggagccccacatc
tcgggacagatcaacgagctgcaccacagtaagcaccacgcgacctacgtcaagggtgtt
aacgacgctgttgccaagttggaggaggcccgcgaaaagggcgaccacgccgcgatcttc
ctcaacgagaagaacctggcgttccacctcggcggccacgtgaaccactcgatctggtgg
aagaacctgtcccccaacggcggtgacaagccgaccggcgatctggccgctgccatcgac
gatcagttcggttcgttcgacaagttccaggcacagttcaccgccgcggccaacggtctg
cagggctcgggctgggcggtgctcggttacgacagcctcggacagaagctgctgaccttc
cagctgtacgaccagcaggccaatgtccctctgggcatcatcccgctgctccaggtcgac
atgtgggagcacgccttctacctgcagtacaagaacgtcaaggccgactacgtgaaggca
ttctggaacgtggtcaactgggccgacgtgcaggaccgctacaccgcggccaccaccaag
acgtcgggtctgatcttcggctga

DBGET integrated database retrieval system